Property Summary

NCBI Gene PubMed Count 18
PubMed Score 165.21
PubTator Score 20.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.500 2.3e-03
aldosterone-producing adenoma -1.279 1.5e-02
astrocytic glioma -2.100 1.1e-02
Astrocytoma, Pilocytic -1.100 9.3e-04
atypical teratoid / rhabdoid tumor -3.300 1.6e-08
autosomal dominant Emery-Dreifuss muscul... 1.099 6.3e-03
Breast cancer -1.300 6.5e-08
ependymoma -2.400 6.4e-03
glioblastoma -1.300 1.9e-04
group 3 medulloblastoma -1.500 6.8e-03
medulloblastoma, large-cell -3.200 1.3e-06
oligodendroglioma -1.500 2.5e-02
ovarian cancer -1.100 5.1e-03
pituitary cancer -1.100 8.4e-04
primitive neuroectodermal tumor -1.700 2.0e-05

Gene RIF (4)

AA Sequence

METPPLPPACTKQGHQKPLDSKDDNTEKHCPVTVNPWHMKKAFKVMNELRSQNLLCDVTIVAEDMEISAH      1 - 70
RVVLAACSPYFHAMFTGEMSESRAKRVRIKEVDGWTLRMLIDYVYTAEIQVTEENVQVLLPAAGLLQLQD     71 - 140
VKKTCCEFLESQLHPVNCLGIRAFADMHACTDLLNKANTYAEQHFADVVLSEEFLNLGIEQVCSLISSDK    141 - 210
LTISSEEKVFEAVIAWVNHDKDVRQEFMARLMEHVRLPLLPREYLVQRVEEEALVKNSSACKDYLIEAMK    211 - 280
YHLLPTEQRILMKSVRTRLRTPMNLPKLMVVVGGQAPKAIRSVECYDFKEERWHQVAELPSRRCRAGMVY    281 - 350
MAGLVFAVGGFNGSLRVRTVDSYDPVKDQWTSVANMRDRRSTLGAAVLNGLLYAVGGFDGSTGLSSVEAY    351 - 420
NIKSNEWFHVAPMNTRRSSVGVGVVGGLLYAVGGYDGASRQCLSTVECYNATTNEWTYIAEMSTRRSGAG    421 - 490
VGVLNNLLYAVGGHDGPLVRKSVEVYDPTTNAWRQVADMNMCRRNAGVCAVNGLLYVVGGDDGSCNLASV    491 - 560
EYYNPTTDKWTVVSSCMSTGRSYAGVTVIDKPL                                         561 - 593
//

Text Mined References (23)

PMID Year Title