Property Summary

NCBI Gene PubMed Count 16
PubMed Score 153.26
PubTator Score 20.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
oligodendroglioma 2849 1.02293532290972E-17
atypical teratoid / rhabdoid tumor 4369 1.55808034656473E-8
Breast cancer 3099 6.50345574737179E-8
medulloblastoma, large-cell 6234 1.34393273373794E-6
medulloblastoma 1524 1.48237636253656E-6
glioblastoma 5572 3.86281449111936E-6
pediatric high grade glioma 2712 5.03364875531202E-6
primitive neuroectodermal tumor 3031 1.9770484868693E-5
pilocytic astrocytoma 3086 4.87271424085983E-4
pituitary cancer 1972 8.36723681006611E-4
ovarian cancer 8492 0.00510192754340412
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00633155031746481
ependymoma 2514 0.00643128227376613
astrocytic glioma 2241 0.0109792067069302
aldosterone-producing adenoma 664 0.0147292415516483

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -2.100 0.011
ependymoma -2.400 0.006
oligodendroglioma -1.800 0.000
glioblastoma -2.200 0.000
medulloblastoma -2.100 0.000
atypical teratoid / rhabdoid tumor -3.300 0.000
medulloblastoma, large-cell -3.200 0.000
primitive neuroectodermal tumor -1.700 0.000
autosomal dominant Emery-Dreifuss muscul... 1.099 0.006
pediatric high grade glioma -1.700 0.000
pilocytic astrocytoma -1.200 0.000
aldosterone-producing adenoma -1.279 0.015
Breast cancer -1.300 0.000
ovarian cancer -1.100 0.005
pituitary cancer -1.100 0.001

Synonym

Accession O95198 A6NCM7 B2RD18 B4DFH7 F5H6M3 Q8N484 Q8TBH5
Symbols MAV
MAYVEN
ABP-KELCH

Gene

PDB

2XN4   4CHB  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

 GWAS Trait (1)

Gene RIF (4)

PMID Text
23838290 Co-expression of KLHL2 and Cullin3 decreases the abundance of WNK1, WNK3 and WNK4 within HEK293T cells.
21549840 Results suggest a novel E3 ubiquitin ligase function of KLHL2, with NPCD as a substrate.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
15735724 overexpression of Mayven may promote tumor growth through c-Jun and cyclin D1

AA Sequence

METPPLPPACTKQGHQKPLDSKDDNTEKHCPVTVNPWHMKKAFKVMNELRSQNLLCDVTIVAEDMEISAH      1 - 70
RVVLAACSPYFHAMFTGEMSESRAKRVRIKEVDGWTLRMLIDYVYTAEIQVTEENVQVLLPAAGLLQLQD     71 - 140
VKKTCCEFLESQLHPVNCLGIRAFADMHACTDLLNKANTYAEQHFADVVLSEEFLNLGIEQVCSLISSDK    141 - 210
LTISSEEKVFEAVIAWVNHDKDVRQEFMARLMEHVRLPLLPREYLVQRVEEEALVKNSSACKDYLIEAMK    211 - 280
YHLLPTEQRILMKSVRTRLRTPMNLPKLMVVVGGQAPKAIRSVECYDFKEERWHQVAELPSRRCRAGMVY    281 - 350
MAGLVFAVGGFNGSLRVRTVDSYDPVKDQWTSVANMRDRRSTLGAAVLNGLLYAVGGFDGSTGLSSVEAY    351 - 420
NIKSNEWFHVAPMNTRRSSVGVGVVGGLLYAVGGYDGASRQCLSTVECYNATTNEWTYIAEMSTRRSGAG    421 - 490
VGVLNNLLYAVGGHDGPLVRKSVEVYDPTTNAWRQVADMNMCRRNAGVCAVNGLLYVVGGDDGSCNLASV    491 - 560
EYYNPTTDKWTVVSSCMSTGRSYAGVTVIDKPL                                         561 - 593
//

Text Mined References (21)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24684796 2014 Heritability and genetic association analysis of cognition in the Diabetes Heart Study.
23838290 2013 KLHL2 interacts with and ubiquitinates WNK kinases.
23676014 2013 Update on the Kelch-like (KLHL) gene family.
23349464 2013 Structural basis for Cul3 protein assembly with the BTB-Kelch family of E3 ubiquitin ligases.
21784977 2011 Zinc finger protein tristetraprolin interacts with CCL3 mRNA and regulates tissue inflammation.
21549840 2011 Interaction of an intracellular pentraxin with a BTB-Kelch protein is associated with ubiquitylation, aggregation and neuronal apoptosis.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...