Property Summary

NCBI Gene PubMed Count 52
Grant Count 12
R01 Count 11
Funding $1,023,751
PubMed Score 36.51
PubTator Score 85.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (1)

Disease log2 FC p
Multiple Sclerosis 1.200 0.001

Gene RIF (29)

PMID Text
26164948 RTN 3 interacts with the N-terminal domain of EV71 2C, which is crucial for replication of viral RNA. [Review]
25319692 In Alzheimer's disease transgenic mouse models, RTN3 deficiency facilitates amyloid deposition.
24898729 Authors demonstrated that the second transmembrane region of RTN3 competed for, and bound to, the AH2 domain of hepatitis C virus NS4B, thus abolishing NS4B self-interaction and leading to the downregulation of viral replication.
23407961 successful prevention of imunoreactive dystrophic neurites formation should be initiated before RTN3 aggregation
22742855 This study demonistrated that Reduction of beta-amyloid accumulation by reticulon 3.
22190034 HIV-1 Vpu is identified to have a physical interaction with reticulon 3 (RTN3) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21964562 we hypothesis that RTN3 may participate in the continuous process of circulating monocyte recruitment in atherosclerosis.
20717916 Reticulons, the only molecular so far to participate in all three apoptosis signaling pathways, may be a novel player in the progress of atherosclerosis.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20374499 we examined reticulon-3 expression in cases of Alzheimer's disease, Parkinson's disease, and diffuse Lewy body disease
More...

AA Sequence

MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCADSFVSSSSSQPVSLFSTSQEGLS      1 - 70
SLCSDEPSSEIMTSSFLSSSEIHNTGLTILHGEKSHVLGSQPILAKEGKDHLDLLDMKKMEKPQGTSNNV     71 - 140
SDSSVSLAAGVHCDRPSIPASFPEHPAFLSKKIGQVEEQIDKETKNPNGVSSREAKTALDADDRFTLLTA    141 - 210
QKPPTEYSKVEGIYTYSLSPSKVSGDDVIEKDSPESPFEVIIDKAAFDKEFKDSYKESTDDFGSWSVHTD    211 - 280
KESSEDISETNDKLFPLRNKEAGRYPMSALLSRQFSHTNAALEEVSRCVNDMHNFTNEILTWDLVPQVKQ    281 - 350
QTDKSSDCITKTTGLDMSEYNSEIPVVNLKTSTHQKTPVCSIDGSTPITKSTGDWAEASLQQENAITGKP    351 - 420
VPDSLNSTKEFSIKGVQGNMQKQDDTLAELPGSPPEKCDSLGSGVATVKVVLPDDHLKDEMDWQSSALGE    421 - 490
ITEADSSGESDDTVIEDITADTSFENNKIQAEKPVSIPSAVVKTGEREIKEIPSCEREEKTSKNFEELVS    491 - 560
DSELHQDQPDILGRSPASEAACSKVPDTNVSLEDVSEVAPEKPITTENPKLPSTVSPNVFNETEFSLNVT    561 - 630
TSAYLESLHGKNVKHIDDSSPEDLIAAFTETRDKGIVDSERNAFKAISEKMTDFKTTPPVEVLHENESGG    631 - 700
SEIKDIGSKYSEQSKETNGSEPLGVFPTQGTPVASLDLEQEQLTIKALKELGERQVEKSTSAQRDAELPS    701 - 770
EEVLKQTFTFAPESWPQRSYDILERNVKNGSDLGISQKPITIRETTRVDAVSSLSKTELVKKHVLARLLT    771 - 840
DFSVHDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAVQKSEEGH    841 - 910
PFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKLAVFMWLMTYVGAVFNGITLL    911 - 980
ILAELLIFSVPIVYEKYKTQIDHYVGIARDQTKSIVEKIQAKLPGIAKKKAE                      981 - 1032
//

Text Mined References (62)

PMID Year Title
26164948 2015 [Molecular Mechanism of Action of hnRNP K and RTN3 in the Replication of Enterovirus 71].
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25612671 2014 Identification and characterization of TMEM33 as a reticulon-binding protein.
25416956 2014 A proteome-scale map of the human interactome network.
25319692 2014 Impact of RTN3 deficiency on expression of BACE1 and amyloid deposition.
24898729 2014 Reticulon 3 interacts with NS4B of the hepatitis C virus and negatively regulates viral replication by disrupting NS4B self-interaction.
24262037 2014 Arl6IP1 has the ability to shape the mammalian ER membrane in a reticulon-like fashion.
23407961 2013 Preventing formation of reticulon 3 immunoreactive dystrophic neurites improves cognitive function in mice.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...