Property Summary

NCBI Gene PubMed Count 11
Grant Count 13
R01 Count 5
Funding $5,439,253.94
PubMed Score 337.31
PubTator Score 9.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

 GO Function (1)

Gene RIF (4)

PMID Text
19367581 results suggest that NGC may be a novel candidate gene, and neuregulin signaling pathways may play an important role in schizophrenia
19367581 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16901907 neuroglycan C is a novel component of midkine receptors involved in process elongation
16299773 NGC IV, which was first found in the present study, had the shortest cytoplasmic domain among the four variants

AA Sequence

MGRAGGGGPGRGPPPLLLFLGAALVLASGAVPAREAGSAVEAEELVKGSPAWEPPANDTREEAGPPAAGE      1 - 70
DEASWTAPGGELAGPEEVLQESAAVTGTAWLEADSPGLGGVTAEAGSGDAQALPATLQAPHEVLGQSIMP     71 - 140
PAIPEATEASGPPSPTPGDKLSPASELPKESPLEVWLNLGGSTPDPQGPELTYPFQGTLEPQPASDIIDI    141 - 210
DYFEGLDGEGRGADLGSFPGSPGTSENHPDTEGETPSWSLLDLYDDFTPFDESDFYPTTSFYDDLDEEEE    211 - 280
EEEDDKDAVGGGDLEDENELLVPTGKPGLGPGTGQPTSRWHAVPPQHTLGSVPGSSIALRPRPGEPGRDL    281 - 350
ASSENGTECRSGFVRHNGSCRSVCDLFPSYCHNGGQCYLVENIGAFCRCNTQDYIWHKGMRCESIITDFQ    351 - 420
VMCVAVGSAALVLLLLFMMTVFFAKKLYLLKTENTKLRRTNKFRTPSELHNDNFSLSTIAEGSHPNVRKL    421 - 490
CNTPRTSSPHARALAHYDNVICQDDPSAPHKIQEVLKSCLKEEESFNIQNSMSPKLEGGKGDQADLDVNC    491 - 560
LQNNLT                                                                    561 - 566
//

Text Mined References (13)

PMID Year Title
23234360 2013 LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
19367581 2010 Identification of neuroglycan C and interacting partners as potential susceptibility genes for schizophrenia in a Southern Chinese population.
16901907 2006 Neuroglycan C is a novel midkine receptor involved in process elongation of oligodendroglial precursor-like cells.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16299773 2006 Expression and identification of a new splice variant of neuroglycan C, a transmembrane chondroitin sulfate proteoglycan, in the human brain.
15358134 2004 Neuroglycan C, a novel member of the neuregulin family.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12885772 2003 CALEB/NGC interacts with the Golgi-associated protein PIST.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...