Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.81
PubTator Score 11.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -2.300 0.000
osteosarcoma -2.310 0.000
ovarian cancer 1.200 0.000

Gene RIF (4)

PMID Text
23260169 Gene expression studies have identified altered expression of ornithine decarboxylase antizyme 2 in suicide completers with a history of mood disorders.
22008221 This study demomistrated that H3K4me3 modification plays an important role in up regulation of OAZ2 in prefrontal cortex.
19960435 elevated ODC and low OAZ2 mRNA expression levels correlate with several unfavorable genetic and clinical features in neuroblastoma.
9782076 The protein product is generated using polyamine-regulated programmed ribosomal frameshifting.

AA Sequence

MINTQDSSILPLSNCPQLQCCRHIVPGPLWCSDAPHPLSKIPGGRGGGRDPSLSALIYKDEKLTVTQDLP      1 - 70
VNDGKPHIVHFQYEVTEVKVSSWDAVLSSQSLFVEIPDGLLADGSKEGLLALLEFAEEKMKVNYVFICFR     71 - 140
KGREDRAPLLKTFSFLGFEIVRPGHPCVPSRPDVMFMVYPLDQNLSDED                         141 - 189
//

Text Mined References (13)

PMID Year Title
23260169 2013 Effects of promoter methylation on increased expression of polyamine biosynthetic genes in suicide.
22008221 2012 Effects of histone modifications on increased expression of polyamine biosynthetic genes in suicide.
19960435 2010 The polyamine metabolism genes ornithine decarboxylase and antizyme 2 predict aggressive behavior in neuroblastomas with and without MYCN amplification.
19725046 2009 Subcellular localization and phosphorylation of antizyme 2.
17900240 2008 Human ornithine decarboxylase paralogue (ODCp) is an antizyme inhibitor but not an arginine decarboxylase.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17332016 2007 Ribosomal frameshifting in decoding antizyme mRNAs from yeast and protists to humans: close to 300 cases reveal remarkable diversity despite underlying conservation.
15355308 2005 Regulation of all members of the antizyme family by antizyme inhibitor.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12359729 2002 Structural elements of antizymes 1 and 2 are required for proteasomal degradation of ornithine decarboxylase.
More...