Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.88
PubTator Score 11.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 1.1e-07
ovarian cancer 8520 2.2e-05
psoriasis 6694 3.1e-05

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -2.310 1.1e-07
ovarian cancer 1.200 2.2e-05
psoriasis -2.300 3.1e-05

Gene RIF (4)

AA Sequence

MINTQDSSILPLSNCPQLQCCRHIVPGPLWCSDAPHPLSKIPGGRGGGRDPSLSALIYKDEKLTVTQDLP      1 - 70
VNDGKPHIVHFQYEVTEVKVSSWDAVLSSQSLFVEIPDGLLADGSKEGLLALLEFAEEKMKVNYVFICFR     71 - 140
KGREDRAPLLKTFSFLGFEIVRPGHPCVPSRPDVMFMVYPLDQNLSDED                         141 - 189
//

Text Mined References (13)

PMID Year Title