Property Summary

NCBI Gene PubMed Count 39
PubMed Score 40.72
PubTator Score 28.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
active ulcerative colitis -1.041 3.0e-02
adrenocortical carcinoma -1.772 2.8e-03
adult high grade glioma -2.100 7.1e-05
astrocytic glioma -1.700 6.5e-03
atypical teratoid / rhabdoid tumor -1.700 3.3e-03
Breast cancer -1.200 7.9e-06
ependymoma -2.000 1.0e-02
glioblastoma -2.000 9.2e-07
group 3 medulloblastoma -1.900 2.8e-04
medulloblastoma, large-cell -1.500 1.0e-03
oligodendroglioma -1.400 2.7e-02
osteosarcoma -1.265 4.1e-02
primitive neuroectodermal tumor -1.300 3.5e-02
psoriasis -1.100 8.4e-16
subependymal giant cell astrocytoma -2.342 3.4e-03

Protein-protein Interaction (1)

Gene RIF (28)

AA Sequence

MRKGLRATAARCGLGLGYLLQMLVLPALALLSASGTGSAAQDDDFFHELPETFPSDPPEPLPHFLIEPEE      1 - 70
AYIVKNKPVNLYCKASPATQIYFKCNSEWVHQKDHIVDERVDETSGLIVREVSIEISRQQVEELFGPEDY     71 - 140
WCQCVAWSSAGTTKSRKAYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDP    141 - 210
VEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIVYVNGGWSTWTEWSVCNSRCGRGY    211 - 280
QKRTRTCTNPAPLNGGAFCEGQSVQKIACTTLCPVDGRWTPWSKWSTCGTECTHWRRRECTAPAPKNGGK    281 - 350
DCDGLVLQSKNCTDGLCMQTAPDSDDVALYVGIVIAVIVCLAISVVVALFVYRKNHRDFESDIIDSSALN    351 - 420
GGFQPVNIKAARQDLLAVPPDLTSAAAMYRGPVYALHDVSDKIPMTNSPILDPLPNLKIKVYNTSGAVTP    421 - 490
QDDLSEFTSKLSPQMTQSLLENEALSLKNQSLARQTDPSCTAFGSFNSLGGHLIVPNSGVSLLIPAGAIP    491 - 560
QGRVYEMYVTVHRKETMRPPMDDSQTLLTPVVSCGPPGALLTRPVVLTMHHCADPNTEDWKILLKNQAAQ    561 - 630
GQWEDVVVVGEENFTTPCYIQLDAEACHILTENLSTYALVGHSTTKAAAKRLKLAIFGPLCCSSLEYSIR    631 - 700
VYCLDDTQDALKEILHLERQMGGQLLEEPKALHFKGSTHNLRLSIHDIAHSLWKSKLLAKYQEIPFYHVW    701 - 770
SGSQRNLHCTFTLERFSLNTVELVCKLCVRQVEGEGQIFQLNCTVSEEPTGIDLPLLDPANTITTVTGPS    771 - 840
AFSIPLPIRQKLCSSLDAPQTRGHDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQNFPDGNLSMLA    841 - 910
AVLEEMGRHETVVSLAAEGQY                                                     911 - 931
//

Text Mined References (40)

PMID Year Title