Property Summary

NCBI Gene PubMed Count 34
PubMed Score 38.99
PubTator Score 28.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count
Renal Cell Carcinoma 199
Disease Target Count P-value
psoriasis 6685 8.38506728717242E-16
posterior fossa group B ependymoma 1530 4.43830018392278E-9
pediatric high grade glioma 2712 1.59762562192173E-7
group 4 medulloblastoma 1875 5.92149996767969E-6
Breast cancer 3099 7.9024828937162E-6
glioblastoma 5572 1.2900607860792E-5
medulloblastoma, large-cell 6234 0.00102858121612264
adrenocortical carcinoma 1427 0.00276442300607715
atypical teratoid / rhabdoid tumor 4369 0.00330215919341221
subependymal giant cell astrocytoma 2287 0.00343868803638961
astrocytic glioma 2241 0.00652228295261836
oligodendroglioma 2849 0.0266272348854625
active ulcerative colitis 477 0.0299702177654531
primitive neuroectodermal tumor 3031 0.0354099693876181
osteosarcoma 7933 0.0413662781938323
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Alzheimer's disease 644 0.0 1.0
Rheumatoid Arthritis 1171 0.0 1.0
Disease Target Count Z-score Confidence
Colorectal Cancer 62 3.464 1.7

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -1.700 0.007
posterior fossa group B ependymoma -2.400 0.000
oligodendroglioma -1.400 0.027
glioblastoma -2.500 0.000
osteosarcoma -1.265 0.041
atypical teratoid / rhabdoid tumor -1.700 0.003
medulloblastoma, large-cell -1.500 0.001
primitive neuroectodermal tumor -1.300 0.035
adrenocortical carcinoma -1.772 0.003
active ulcerative colitis -1.041 0.030
pediatric high grade glioma -2.300 0.000
group 4 medulloblastoma -2.100 0.000
subependymal giant cell astrocytoma -2.342 0.003
Breast cancer -1.200 0.000
psoriasis -1.100 0.000

Synonym

Accession O95185 Q8IUT0
Symbols UNC5H3

Gene

PANTHER Protein Class (1)

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (23)

PMID Text
26859457 identify the V-2 domain of netrin-1 to be important for its interaction with the Ig1/Ig2 domains of UNC5H2
25419706 T835M (rs137875858) in the UNC5C was associated with late-onset Alzheimer disease and increased cell death in HEK293 cells.
25316812 we have identified novel frequent somatic mutations of UNC5C in muscle-invasive bladder cancers.
24866402 The rare coding variant might not play an important role in AD risk in mainland China.
24415873 UNC5C mutations are very rare in familial and sporadic colorectal carcinomas.
23178624 TNM stage 1 hepatocellular carcinoma (HCC) presented UNC5C methylation, indicating that the UNC5C gene has been methylated from the early stages of HCC.
22685302 knockdown of DSCAM inhibits netrin-induced tyrosine phosphorylation of UNC5C and Fyn as well as the interaction of UNC5C with Fyn. The double knockdown of both receptors abolishes the induction of Fyn tyrosine phosphorylation by netrin-1
21893118 Inherited mutations in UNC5C prevent apoptosis and increase risk of colorectal cancer.
21600761 UNC5C acts as a tumour suppressor in RCC and is down-regulated in RCC. Loss of heterozygosity and DNA methylation contribute to the inactivation of UNC5C in renal cell carcinoma.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MRKGLRATAARCGLGLGYLLQMLVLPALALLSASGTGSAAQDDDFFHELPETFPSDPPEPLPHFLIEPEE      1 - 70
AYIVKNKPVNLYCKASPATQIYFKCNSEWVHQKDHIVDERVDETSGLIVREVSIEISRQQVEELFGPEDY     71 - 140
WCQCVAWSSAGTTKSRKAYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDP    141 - 210
VEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIVYVNGGWSTWTEWSVCNSRCGRGY    211 - 280
QKRTRTCTNPAPLNGGAFCEGQSVQKIACTTLCPVDGRWTPWSKWSTCGTECTHWRRRECTAPAPKNGGK    281 - 350
DCDGLVLQSKNCTDGLCMQTAPDSDDVALYVGIVIAVIVCLAISVVVALFVYRKNHRDFESDIIDSSALN    351 - 420
GGFQPVNIKAARQDLLAVPPDLTSAAAMYRGPVYALHDVSDKIPMTNSPILDPLPNLKIKVYNTSGAVTP    421 - 490
QDDLSEFTSKLSPQMTQSLLENEALSLKNQSLARQTDPSCTAFGSFNSLGGHLIVPNSGVSLLIPAGAIP    491 - 560
QGRVYEMYVTVHRKETMRPPMDDSQTLLTPVVSCGPPGALLTRPVVLTMHHCADPNTEDWKILLKNQAAQ    561 - 630
GQWEDVVVVGEENFTTPCYIQLDAEACHILTENLSTYALVGHSTTKAAAKRLKLAIFGPLCCSSLEYSIR    631 - 700
VYCLDDTQDALKEILHLERQMGGQLLEEPKALHFKGSTHNLRLSIHDIAHSLWKSKLLAKYQEIPFYHVW    701 - 770
SGSQRNLHCTFTLERFSLNTVELVCKLCVRQVEGEGQIFQLNCTVSEEPTGIDLPLLDPANTITTVTGPS    771 - 840
AFSIPLPIRQKLCSSLDAPQTRGHDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQNFPDGNLSMLA    841 - 910
AVLEEMGRHETVVSLAAEGQY                                                     911 - 931
//

Text Mined References (35)

PMID Year Title
26859457 2016 Structural Decoding of the Netrin-1/UNC5 Interaction and its Therapeutical Implications in Cancers.
25419706 2014 A rare mutation in UNC5C predisposes to late-onset Alzheimer's disease and increases neuronal cell death.
25316812 2014 Whole-exome sequencing of muscle-invasive bladder cancer identifies recurrent mutations of UNC5C and prognostic importance of DNA repair gene mutations on survival.
24866402 2014 Investigation of TREM2, PLD3, and UNC5C variants in patients with Alzheimer's disease from mainland China.
24415873 2014 Evaluation of the colorectal cancer risk conferred by rare UNC5C alleles.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23178624 Methylation of the UNC5C gene is frequently detected in hepatocellular carcinoma.
22685302 2012 Down syndrome cell adhesion molecule (DSCAM) associates with uncoordinated-5C (UNC5C) in netrin-1-mediated growth cone collapse.
21893118 2011 Variants in the netrin-1 receptor UNC5C prevent apoptosis and increase risk of familial colorectal cancer.
21600761 2011 Genetic and epigenetic control of UNC5C expression in human renal cell carcinoma.
More...