Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.73
PubTator Score 5.37

Knowledge Summary

Patent

No data available

Expression

 GWAS Trait (1)

 CSPA Cell Line (1)

Gene RIF (2)

AA Sequence

MAGIELERCQQQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSSTFNKTTQNLAQKKCWENIRYR      1 - 70
ICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN                             71 - 116
//

Text Mined References (12)

PMID Year Title