Property Summary

NCBI Gene PubMed Count 11
Grant Count 4
R01 Count 4
Funding $335,386.5
PubMed Score 4.57
PubTator Score 5.37

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
16110299 Observational study of gene-disease association. (HuGE Navigator)
16110299 Our findings indicate that VAMP5 and VAMP8 are not involved in POAG in the Dutch population.

AA Sequence

MAGIELERCQQQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSSTFNKTTQNLAQKKCWENIRYR      1 - 70
ICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN                             71 - 116
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21743467 2011 Seven prostate cancer susceptibility loci identified by a multi-stage genome-wide association study.
21151919 2010 Fusogenic pairings of vesicle-associated membrane proteins (VAMPs) and plasma membrane t-SNAREs--VAMP5 as the exception.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
16110299 2005 VAMP5 and VAMP8 are most likely not involved in primary open-angle glaucoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12682051 2003 The cytoplasmic domain of Vamp4 and Vamp5 is responsible for their correct subcellular targeting: the N-terminal extenSion of VAMP4 contains a dominant autonomous targeting signal for the trans-Golgi network.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...