Property Summary

Ligand Count 1
NCBI Gene PubMed Count 15
PubMed Score 2.00
PubTator Score 1.68

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
ependymoma -1.100 1.3e-02

Gene RIF (4)

AA Sequence

MASATRLIQRLRNWASGHDLQGKLQLRYQEISKRTQPPPKLPVGPSHKLSNNYYCTRDGRRESVPPSIIM      1 - 70
SSQKALVSGKPAESSAVAATEKKAVTPAPPIKRWELSSDQPYL                                71 - 113
//

Text Mined References (18)

PMID Year Title