Property Summary

NCBI Gene PubMed Count 77
Grant Count 35
R01 Count 8
Funding $4,344,437.01
PubMed Score 125.81
PubTator Score 127.86

Knowledge Summary

Patent (3,547)

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
osteosarcoma 2.620 0.000
lung carcinoma 1.800 0.000
psoriasis -2.000 0.000

MLP Assay (10)

AID Type Active / Inconclusive / Inactive Description
449739 screening 4230 / 0 / 100512 Inhibitors of Cav3 T-type Calcium Channels: Primary Screen
463087 summary 0 / 0 / 0 Inhibitors of Cav3 T-type Calcium Channels
489005 confirmatory 703 / 0 / 192 Inhibitors of T-Type Calcium Channel
493021 confirmatory 17 / 0 / 0 Inhibitors of T-Type Calcium Channels
493022 confirmatory 41 / 0 / 3 Inhibitors of T-Type Calcium Channels (SynthLib1)
493023 confirmatory 25 / 0 / 4 Inhibitors of T-Type Calcium Channels (SynthLib2)
493041 confirmatory 24 / 0 / 8 Inhibitors of T-Type Calcium Channels (SynthLib3)
504426 confirmatory 2 / 0 / 2 Mode of action assay-Dose response assay for compounds that inhibit T-type calcium channel subunit Cav3.2 on automated patch clamp
504619 confirmatory 1 / 0 / 0 Inhibitors of T-Type Calcium Channels (Cav3.2 HEK whole cell CRC)
504628 other 1 / 0 / 0 Inhibitors of T-Type Calcium Channels (Cav3.2 HEK whole cell)

Gene RIF (62)

PMID Text
26483470 Cav3.2 channels are highly phosphorylated in the mammalian brain and establish phosphorylation as an important mechanism involved in the dynamic regulation of Cav3.2 channel gating properties
26220996 reveal an unexpected role of CaV3.2 channels in regulating NMDA-R-mediated transmission and a novel epileptogenic mechanism for human childhood absence epilepsy
26216687 Study revealed no association between the 15 tagSNPs of CACNA1A, 1C, and 1H and antiepileptic drug efficacy in the Chinese Han epileptic population; the TAGAA haplotype of CACNA1A may be a risk factor for drug resistance
25931121 The I-II loop of the Cav3.2 protein inhibits neuronal Cav3.1 and Cav3.2 channels.
25907736 Recurrent gain of function mutation in calcium channel CACNA1H causes early-onset hypertension with primary aldosteronism.
24508802 Data indicate that endogenous/exogenous hydrogen sulfide regulates function of T-type Ca(2+) channel Cav3.2 expressed in HEK293 cells
24277868 C456S mutation leads to substantially increased excitability of cultured neurons due to increased spontaneous firing rate.
23970551 Results indicate that the S4-S5 and S6 helices from adjacent domains are energetically coupled during the activation of a low voltage-gated T-type CaV3.2 channel.
23903007 It plays pivotal roles in processing of pain signals.(review)
23849427 Both Asp residues critically control the biophysical properties of Ca(v)3.2, including relative permeability between Ba2+ and Ca2+, voltage dependency of channel activation, Cd2+ blocking sensitivity, and pH effects, in distinctive ways.
More...

AA Sequence

MTEGARAADEVRVPLGAPPPGPAALVGASPESPGAPGREAERGSELGVSPSESPAAERGAELGADEEQRV      1 - 70
PYPALAATVFFCLGQTTRPRSWCLRLVCNPWFEHVSMLVIMLNCVTLGMFRPCEDVECGSERCNILEAFD     71 - 140
AFIFAFFAVEMVIKMVALGLFGQKCYLGDTWNRLDFFIVVAGMMEYSLDGHNVSLSAIRTVRVLRPLRAI    141 - 210
NRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCFLDSAFVRNNNLTFLRPYYQ    211 - 280
TEEGEENPFICSSRRDNGMQKCSHIPGRRELRMPCTLGWEAYTQPQAEGVGAARNACINWNQYYNVCRSG    281 - 350
DSNPHNGAINFDNIGYAWIAIFQVITLEGWVDIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIAT    351 - 420
QFSETKQRESQLMREQRARHLSNDSTLASFSEPGSCYEELLKYVGHIFRKVKRRSLRLYARWQSRWRKKV    421 - 490
DPSAVQGQGPGHRQRRAGRHTASVHHLVYHHHHHHHHHYHFSHGSPRRPGPEPGACDTRLVRAGAPPSPP    491 - 560
SPGRGPPDAESVHSIYHADCHIEGPQERARVAHAAATAAASLRLATGLGTMNYPTILPSGVGSGKGSTSP    561 - 630
GPKGKWAGGPPGTGGHGPLSLNSPDPYEKIPHVVGEHGLGQAPGHLSGLSVPCPLPSPPAGTLTCELKSC    631 - 700
PYCTRALEDPEGELSGSESGDSDGRGVYEFTQDVRHGDRWDPTRPPRATDTPGPGPGSPQRRAQQRAAPG    701 - 770
EPGWMGRLWVTFSGKLRRIVDSKYFSRGIMMAILVNTLSMGVEYHEQPEELTNALEISNIVFTSMFALEM    771 - 840
LLKLLACGPLGYIRNPYNIFDGIIVVISVWEIVGQADGGLSVLRTFRLLRVLKLVRFLPALRRQLVVLVK    841 - 910
TMDNVATFCTLLMLFIFIFSILGMHLFGCKFSLKTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVL    911 - 980
YNGMASTSSWAALYFVALMTFGNYVLFNLLVAILVEGFQAEGDANRSDTDEDKTSVHFEEDFHKLRELQT    981 - 1050
TELKMCSLAVTPNGHLEGRGSLSPPLIMCTAATPMPTPKSSPFLDAAPSLPDSRRGSSSSGDPPLGDQKP   1051 - 1120
PASLRSSPCAPWGPSGAWSSRRSSWSSLGRAPSLKRRGQCGERESLLSGEGKGSTDDEAEDGRAAPGPRA   1121 - 1190
TPLRRAESLDPRPLRPAALPPTKCRDRDGQVVALPSDFFLRIDSHREDAAELDDDSEDSCCLRLHKVLEP   1191 - 1260
YKPQWCRSREAWALYLFSPQNRFRVSCQKVITHKMFDHVVLVFIFLNCVTIALERPDIDPGSTERVFLSV   1261 - 1330
SNYIFTAIFVAEMMVKVVALGLLSGEHAYLQSSWNLLDGLLVLVSLVDIVVAMASAGGAKILGVLRVLRL   1331 - 1400
LRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAFFIIFGILGVQLFKGKFYYCEGPDTRNISTK   1401 - 1470
AQCRAAHYRWVRRKYNFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVGVDQQPVQNHNPWMLLYFISFLL   1471 - 1540
IVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLERRRRSTFPSPEAQRRPYYADYSPTRRSI   1541 - 1610
HSLCTSHYLDLFITFIICVNVITMSMEHYNQPKSLDEALKYCNYVFTIVFVFEAALKLVAFGFRRFFKDR   1611 - 1680
WNQLDLAIVLLSLMGITLEEIEMSAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVG   1681 - 1750
NLGLLFMLLFFIYAALGVELFGRLECSEDNPCEGLSRHATFSNFGMAFLTLFRVSTGDNWNGIMKDTLRE   1751 - 1820
CSREDKHCLSYLPALSPVYFVTFVLVAQFVLVNVVVAVLMKHLEESNKEAREDAELDAEIELEMAQGPGS   1821 - 1890
ARRVDADRPPLPQESPGARDAPNLVARKVSVSRMLSLPNDSYMFRPVVPASAPHPRPLQEVEMETYGAGT   1891 - 1960
PLGSVASVHSPPAESCASLQIPLAVSSPARSGEPLHALSPRGTARSPSLSRLLCRQEAVHTDSLEGKIDS   1961 - 2030
PRDTLDPAEPGEKTPVRPVTQGGSLQSPPRSPRPASVRTRKHTFGQRCVSSRPAAPGGEEAEASDPADEE   2031 - 2100
VSHITSSACPWQPTAEPHGPEASPVAGGERDLRRLYSVDAQGFLDKPGRADEQWRPSAELGSGEPGEAKA   2101 - 2170
WGPEAEPALGARRKKKMSPPCISVEPPAEDEGSARPSAAEGGSTTLRRRTPSCEATPHRDSLEPTEGSGA   2171 - 2240
GGDPAAKGERWGQASCRAEHLTVPSFAFEPLDLGVPSGDPFLDGSHSVTPESRASSSGAIVPLEPPESEP   2241 - 2310
PMPVGDPPEKRRGLYLTVPQCPLEKPGSPSATPAPGGGADDPV                              2311 - 2353
//

Text Mined References (79)

PMID Year Title
26483470 2015 Phosphorylation of the Cav3.2 T-type calcium channel directly regulates its gating properties.
26220996 2015 CaV3.2 calcium channels control NMDA receptor-mediated transmission: a new mechanism for absence epilepsy.
26216687 2015 Association study between polymorphisms in the CACNA1A, CACNA1C, and CACNA1H genes and drug-resistant epilepsy in the Chinese Han population.
25931121 2015 Inhibition of Cav3.2 T-type Calcium Channels by Its Intracellular I-II Loop.
25907736 2015 Recurrent gain of function mutation in calcium channel CACNA1H causes early-onset hypertension with primary aldosteronism.
24508802 2014 Endogenous and exogenous hydrogen sulfide facilitates T-type calcium channel currents in Cav3.2-expressing HEK293 cells.
24277868 2014 Mechanisms by which a CACNA1H mutation in epilepsy patients increases seizure susceptibility.
23970551 2013 Cooperative activation of the T-type CaV3.2 channel: interaction between Domains II and III.
23903007 2013 T-type calcium channels: functional regulation and implication in pain signaling.
23849427 2013 Asp residues of the Glu-Glu-Asp-Asp pore filter contribute to ion permeation and selectivity of the Ca(v)3.2 T-type channel.
More...