Property Summary

Ligand Count 1
NCBI Gene PubMed Count 12
PubMed Score 52.61
PubTator Score 24.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer 1.100 2.2e-04
Multiple myeloma 1.500 5.8e-04
ovarian cancer -1.100 1.4e-03
psoriasis 1.200 6.0e-04

Gene RIF (3)

AA Sequence

MSALTRLASFARVGGRLFRSGCARTAGDGGVRHAGGGVHIEPRYRQFPQLTRSQVFQSEFFSGLMWFWIL      1 - 70
WRFWHDSEEVLGHFPYPDPSQWTDEELGIPPDDED                                        71 - 105
//

Text Mined References (14)

PMID Year Title