Property Summary

NCBI Gene PubMed Count 11
PubMed Score 43.04
PubTator Score 24.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.500 0.001
psoriasis 1.200 0.001
lung cancer -1.600 0.048
ovarian cancer -1.100 0.001

Synonym

Accession O95178 Q6FGI6
Symbols AGGG
CI-AGGG

Gene

Gene RIF (3)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
19064571 Observational study of gene-disease association. (HuGE Navigator)
14718445 NADH:ubiquinone oxidoreductase gene may have a role in the regulation of molecular changes during the global cardiac ischemia/reperfusion injury during CPB

AA Sequence

MSALTRLASFARVGGRLFRSGCARTAGDGGVRHAGGGVHIEPRYRQFPQLTRSQVFQSEFFSGLMWFWIL      1 - 70
WRFWHDSEEVLGHFPYPDPSQWTDEELGIPPDDED                                        71 - 105
//

Text Mined References (13)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19892738 2009 Global profiling of protease cleavage sites by chemoselective labeling of protein N-termini.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14718445 2004 Differential-display polymerase chain reaction identifies nicotinamide adenine dinucleotide-ubiquinone oxidoreductase as an ischemia/reperfusion-regulated gene in cardiomyocytes.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12611891 2003 The subunit composition of the human NADH dehydrogenase obtained by rapid one-step immunopurification.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
More...