Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.33
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Papillary thyroid carcinoma 43
Disease Target Count Z-score Confidence
Nodular Goiter 6 3.462 1.7
Thyroid cancer 36 3.048 1.5

 Compartment GO Term (1)

Protein-protein Interaction (1)

Gene RIF (1)

AA Sequence

MKLSSAAGQESPGHPHPSPPAWTLKKPSESVAQRAMCSARACPVACPVGCPAACPVGCPIACPVSCPVAC      1 - 70
PVGCPVGSMATAPQGLSPQEWEADRETGSSSHAGTTQCSIHSPSSSSRHLSRTQT                    71 - 125
//

Text Mined References (7)

PMID Year Title