Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.33
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Papillary thyroid carcinoma 37 3.103 1.6

Synonym

Accession O95177 O95176 Q52LX9
Symbols C16orf3

Gene

 Compartment GO Term (1)

AA Sequence

MKLSSAAGQESPGHPHPSPPAWTLKKPSESVAQRAMCSARACPVACPVGCPAACPVGCPIACPVSCPVAC      1 - 70
PVGCPVGSMATAPQGLSPQEWEADRETGSSSHAGTTQCSIHSPSSSSRHLSRTQT                    71 - 125
//

Text Mined References (4)

PMID Year Title
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9790751 1998 Characterization and screening for mutations of the growth arrest-specific 11 (GAS11) and C16orf3 genes at 16q24.3 in breast cancer.