Property Summary

NCBI Gene PubMed Count 14
PubMed Score 23.49
PubTator Score 16.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Atopic dermatitis -2.400 1.3e-04
cutaneous lupus erythematosus -2.000 2.7e-03
cystic fibrosis 1.700 1.4e-04
esophageal adenocarcinoma -4.400 2.5e-02
interstitial lung disease -1.700 2.6e-02
intraductal papillary-mucinous neoplasm ... 3.300 1.8e-04
lung adenocarcinoma -1.600 7.7e-06
lung cancer -4.400 5.9e-06
lung carcinoma -4.800 3.5e-45
nasopharyngeal carcinoma -2.500 1.4e-04
non-small cell lung cancer -1.631 2.2e-12
pancreatic cancer 2.800 1.8e-05
psoriasis -1.400 1.4e-02
spina bifida -1.996 4.8e-02

Gene RIF (4)

AA Sequence

MSNVTLRKMSPTGNEMKSTTQGTTRKQQDFHEVNKRRTFLQDNSWIKKRPEEEKDENYGRVVLNRHNSHD      1 - 70
ALDRKVNERDVPKATISRYSSDDTLDRISDRNDAAKTYKANTLDNQLTNRSMSMFRSLEVTKLQPGGSLN     71 - 140
ANTSNTIASTSATTPVKKKRQSWFPPPPPGYNASSSTGTRRREPGVHPPIPPKPSSPVSSPNQLRQDNRQ    141 - 210
IHPPKPGVYTETNRSAERNIRSQDLDNIVKVATSLQRSDKGEELDNLIKMNKSLNRNQGLDSLFRANPKV    211 - 280
EEREKRAKSLESLIYMSTRTDKDGKGIQSLGSPIKVNQRTDKNEKGRQNLESVAKVNARMNKTSRRSEDL    281 - 350
DNATEVNPKGHENTTGKKDLDGLIKVDPETNKNITRGQSLDNLIKVTPEVKRSNQGSKDLNNFIKVYPGT    351 - 420
EKSTEGGQSLDSLIKVTPERNRTNQGNQDLENLIKVIPSANKSSEQGLDEHINVSPKAVKNTDGKQDLDK    421 - 490
LIKVNPEIFTNNQRNQDLANLIKVNPAVIRNNQSQDLDNLIKVKPSALRNTNRDQNLENLIEVNSHVSEN    491 - 560
KNGSSNTGAKQAGPQDTVVYTRTYVENSKSPKDGYQENISGKYIQTVYSTSDRSVIERDMCTYCRKPLGV    561 - 630
ETKMILDELQICCHSTCFKCEICKQPLENLQAGDSIWIYRQTIHCEPCYSKIMAKWIP                631 - 688
//

Text Mined References (17)

PMID Year Title