Property Summary

Ligand Count 1
NCBI Gene PubMed Count 22
PubMed Score 127.62
PubTator Score 62.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma -1.100 2.2e-02
ependymoma -1.200 2.2e-02
glioblastoma -1.700 2.0e-04
Multiple myeloma 1.124 6.8e-04

Protein-protein Interaction (10)

Gene RIF (4)

AA Sequence

MAVARAGVLGVQWLQRASRNVMPLGARTASHMTKDMFPGPYPRTPEERAAAAKKYNMRVEDYEPYPDDGM      1 - 70
GYGDYPKLPDRSQHERDPWYSWDQPGLRLNWGEPMHWHLDMYNRNRVDTSPTPVSWHVMCMQLFGFLAFM     71 - 140
IFMCWVGDVYPVYQPVGPKQYPYNNLYLERGGDPSKEPERVVHYEI                            141 - 186
//

Text Mined References (24)

PMID Year Title