Property Summary

NCBI Gene PubMed Count 20
Grant Count 25
R01 Count 8
Funding $4,588,580.01
PubMed Score 121.51
PubTator Score 62.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.124 0.001
astrocytoma -1.500 0.001
ependymoma -1.200 0.022
glioblastoma -1.700 0.000

Gene RIF (4)

PMID Text
19064571 Observational study of gene-disease association. (HuGE Navigator)
18977241 Observational study of gene-disease association. (HuGE Navigator)
17727244 Results describe PTEN and NDUFB8 aberrations in cervical cancer tissue.
17601350 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAVARAGVLGVQWLQRASRNVMPLGARTASHMTKDMFPGPYPRTPEERAAAAKKYNMRVEDYEPYPDDGM      1 - 70
GYGDYPKLPDRSQHERDPWYSWDQPGLRLNWGEPMHWHLDMYNRNRVDTSPTPVSWHVMCMQLFGFLAFM     71 - 140
IFMCWVGDVYPVYQPVGPKQYPYNNLYLERGGDPSKEPERVVHYEI                            141 - 186
//

Text Mined References (22)

PMID Year Title
23362303 2013 Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium.
21269460 2011 Initial characterization of the human central proteome.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17727244 2007 PTEN and NDUFB8 aberrations in cervical cancer tissue.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
16806233 2007 Identifying leukocyte gene expression patterns associated with plasma lipid levels in human subjects.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...