Property Summary

Ligand Count 1
NCBI Gene PubMed Count 13
PubMed Score 1.47
PubTator Score 30.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.444 7.0e-04
non primary Sjogren syndrome sicca 1.500 3.8e-02
ovarian cancer 2.000 9.7e-05
psoriasis 1.400 3.6e-04
tuberculosis 1.200 5.5e-07

Gene RIF (6)

AA Sequence

MAARVGAFLKNAWDKEPVLVVSFVVGGLAVILPPLSPYFKYSVMINKATPYNYPVPVRDDGNMPDVPSHP      1 - 70
QDPQGPSLEWLKKL                                                             71 - 84
//

Text Mined References (17)

PMID Year Title