Property Summary

NCBI Gene PubMed Count 76
PubMed Score 148.07
PubTator Score 670.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

 MGI Phenotype (1)

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (41)

AA Sequence

MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHL      1 - 70
RAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL                            71 - 117
//

Text Mined References (83)

PMID Year Title