Property Summary

NCBI Gene PubMed Count 17
PubMed Score 3.10
PubTator Score 44.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Atopic dermatitis -1.500 5.3e-05
atypical teratoid / rhabdoid tumor -1.600 6.1e-08
Breast cancer 3.100 3.0e-02
cystic fibrosis -1.200 1.5e-04
ependymoma 1.700 1.0e-02
gastric carcinoma -1.200 2.3e-02
glioblastoma -1.100 4.8e-04
group 3 medulloblastoma -1.200 1.1e-05
lung adenocarcinoma -2.200 3.7e-14
lung cancer -2.000 5.3e-05
medulloblastoma, large-cell -1.400 9.3e-04
nasopharyngeal carcinoma -1.100 2.1e-05
non-small cell lung cancer -1.662 3.9e-26
ovarian cancer -1.800 3.9e-06
Pick disease -1.100 6.1e-04
progressive supranuclear palsy -1.100 8.0e-03
Rheumatoid arthritis 1.100 9.5e-03
spina bifida -1.560 3.6e-02

Gene RIF (1)

AA Sequence

MSSNVPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGN      1 - 70
VTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCCVIL                            71 - 117
//

Text Mined References (18)

PMID Year Title