Property Summary

NCBI Gene PubMed Count 17
Grant Count 1
Funding $285,000
PubMed Score 3.10
PubTator Score 44.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Rheumatoid Arthritis 1.100 0.010
ependymoma 1.700 0.010
sonic hedgehog group medulloblastoma -2.000 0.000
atypical teratoid / rhabdoid tumor -1.600 0.000
glioblastoma -1.100 0.000
medulloblastoma, large-cell -2.000 0.000
Atopic dermatitis -1.500 0.000
non-small cell lung cancer -1.662 0.000
lung cancer -2.800 0.000
Breast cancer 3.100 0.030
cystic fibrosis -1.200 0.000
lung adenocarcinoma -2.200 0.000
nasopharyngeal carcinoma -1.100 0.000
spina bifida -1.560 0.036
Pick disease -1.100 0.001
progressive supranuclear palsy -1.100 0.008
gastric carcinoma -1.500 0.035
ovarian cancer -2.000 0.000

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSSNVPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGN      1 - 70
VTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCCVIL                            71 - 117
//

Text Mined References (18)

PMID Year Title
23738518 2013 A genome-wide association study for reading and language abilities in two population cohorts.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
20460270 2010 Genome-wide association study identifies a susceptibility locus for biliary atresia on 10q24.2.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17567738 2007 Solution structure of a membrane-anchored ubiquitin-fold (MUB) protein from Homo sapiens.
16831869 2006 MUBs, a family of ubiquitin-fold proteins that are plasma membrane-anchored by prenylation.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
More...