Property Summary

NCBI Gene PubMed Count 8
PubMed Score 16.53
PubTator Score 6.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.600 5.9e-04
astrocytic glioma -1.200 2.7e-02
Astrocytoma, Pilocytic -1.100 6.2e-03
atypical teratoid / rhabdoid tumor -1.600 1.0e-05
glioblastoma -1.700 2.5e-05
group 4 medulloblastoma -1.500 1.3e-03
medulloblastoma, large-cell -1.800 1.7e-06
non primary Sjogren syndrome sicca 1.300 1.5e-02
osteosarcoma 1.038 5.7e-04
primitive neuroectodermal tumor -1.100 1.3e-02

Gene RIF (1)

AA Sequence

MGLCKCPKRKVTNLFCFEHRVNVCEHCLVANHAKCIVQSYLQWLQDSDYNPNCRLCNIPLASRETTRLVC      1 - 70
YDLFHWACLNERAAQLPRNTAPAGYQCPSCNGPIFPPTNLAGPVASALREKLATVNWARAGLGLPLIDEV     71 - 140
VSPEPEPLNTSDFSDWSSFNASSTPGPEEVDSASAAPAFYSQAPRPPASPGRPEQHTVIHMGNPEPLTHA    141 - 210
PRKVYDTRDDDRTPGLHGDCDDDKYRRRPALGWLARLLRSRAGSRKRPLTLLQRAGLLLLLGLLGFLALL    211 - 280
ALMSRLGRAAADSDPNLDPLMNPHIRVGPS                                            281 - 310
//

Text Mined References (11)

PMID Year Title