Property Summary

NCBI Gene PubMed Count 8
PubMed Score 16.00
PubTator Score 6.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.200 0.027
osteosarcoma 1.038 0.001
atypical teratoid / rhabdoid tumor -1.600 0.000
glioblastoma -1.700 0.000
group 4 medulloblastoma -1.500 0.001
medulloblastoma, large-cell -1.800 0.000
primitive neuroectodermal tumor -1.100 0.013
adult high grade glioma -1.600 0.001
non primary Sjogren syndrome sicca 1.300 0.015

Synonym

Accession O95159 A8K7E9 O14616 Q9UID0
Symbols MCG4
D11S750

Gene

Gene RIF (1)

PMID Text
18323775 These data suggest that ZFPL1 has an important function in maintaining the integrity of the cis-Golgi and that it does so through interactions with GM130.

AA Sequence

MGLCKCPKRKVTNLFCFEHRVNVCEHCLVANHAKCIVQSYLQWLQDSDYNPNCRLCNIPLASRETTRLVC      1 - 70
YDLFHWACLNERAAQLPRNTAPAGYQCPSCNGPIFPPTNLAGPVASALREKLATVNWARAGLGLPLIDEV     71 - 140
VSPEPEPLNTSDFSDWSSFNASSTPGPEEVDSASAAPAFYSQAPRPPASPGRPEQHTVIHMGNPEPLTHA    141 - 210
PRKVYDTRDDDRTPGLHGDCDDDKYRRRPALGWLARLLRSRAGSRKRPLTLLQRAGLLLLLGLLGFLALL    211 - 280
ALMSRLGRAAADSDPNLDPLMNPHIRVGPS                                            281 - 310
//

Text Mined References (11)

PMID Year Title
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
18323775 2008 ZFPL1, a novel ring finger protein required for cis-Golgi integrity and efficient ER-to-Golgi transport.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14671302 2003 Inferring nonneutral evolution from human-chimp-mouse orthologous gene trios.
12878157 2003 Redifferentiation of dedifferentiated chondrocytes and chondrogenesis of human bone marrow stromal cells via chondrosphere formation with expression profiling by large-scale cDNA analysis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9653652 1998 A putative human zinc-finger gene (ZFPL1) on 11q13, highly conserved in the mouse and expressed in exocrine pancreas. The European Consortium on MEN 1.
More...