Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.69
PubTator Score 34.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Ovarian Cysts 41 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Omphalocele 24 3.831 1.9

Expression

  Differential Expression (3)

Disease log2 FC p
diabetes mellitus 1.400 1.3e-03
posterior fossa group A ependymoma -1.100 7.9e-06
primitive neuroectodermal tumor -1.100 4.4e-03

Gene RIF (1)

AA Sequence

MRLRPLPLVVVPGLLQLLFCDSKEVVHATEGLDWEDKDAPGTLVGNVVHSRIISPLRLFVKQSPVPKPGP      1 - 70
MAYADSMENFWDWLANITEIQEPLARTKRRPIVKTGKFKKMFGWGDFHSNIKTVKLNLLITGKIVDHGNG     71 - 140
TFSVYFRHNSTGLGNVSVSLVPPSKVVEFEVSPQSTLETKESKSFNCRIEYEKTDRAKKTALCNFDPSKI    141 - 210
CYQEQTQSHVSWLCSKPFKVICIYIAFYSVDYKLVQKVCPDYNYHSETPYLSSG                    211 - 264
//

Text Mined References (8)

PMID Year Title