Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.03
PubTator Score 34.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Ovarian Cysts 34
Disease Target Count P-value
posterior fossa group A ependymoma 1511 7.85903287195013E-6
diabetes mellitus 1663 0.00125284884947534
primitive neuroectodermal tumor 3031 0.00435302899043449
Disease Target Count Z-score Confidence
Male infertility 170 0.0 1.0
substance-related disorder 105 0.0 1.0
Disease Target Count Z-score Confidence
Omphalocele 22 3.811 1.9

Expression

  Differential Expression (3)

Disease log2 FC p
primitive neuroectodermal tumor -1.100 0.004
diabetes mellitus 1.400 0.001
posterior fossa group A ependymoma -1.100 0.000

AA Sequence

MRLRPLPLVVVPGLLQLLFCDSKEVVHATEGLDWEDKDAPGTLVGNVVHSRIISPLRLFVKQSPVPKPGP      1 - 70
MAYADSMENFWDWLANITEIQEPLARTKRRPIVKTGKFKKMFGWGDFHSNIKTVKLNLLITGKIVDHGNG     71 - 140
TFSVYFRHNSTGLGNVSVSLVPPSKVVEFEVSPQSTLETKESKSFNCRIEYEKTDRAKKTALCNFDPSKI    141 - 210
CYQEQTQSHVSWLCSKPFKVICIYIAFYSVDYKLVQKVCPDYNYHSETPYLSSG                    211 - 264
//

Text Mined References (7)

PMID Year Title
21956439 2012 Genome-wide association study of alcohol dependence implicates KIAA0040 on chromosome 1q.
19478329 Genome-wide study of single-nucleotide polymorphisms associated with azoospermia and severe oligozoospermia.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9570794 1998 Neurexophilins form a conserved family of neuropeptide-like glycoproteins.
8699246 1996 Structure and evolution of neurexophilin.