Property Summary

NCBI Gene PubMed Count 29
Grant Count 37
R01 Count 24
Funding $3,432,654.14
PubMed Score 67.42
PubTator Score 45.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis -2.900 0.000
osteosarcoma -1.837 0.000
atypical teratoid / rhabdoid tumor 1.100 0.001
medulloblastoma, large-cell 1.600 0.000
non-small cell lung cancer 1.062 0.000
aldosterone-producing adenoma -1.203 0.007
subependymal giant cell astrocytoma -2.103 0.014
ovarian cancer -1.100 0.000
pancreatic cancer -1.200 0.003

Gene RIF (14)

PMID Text
26673821 UBE4B promotes endogenous phospho-p53(S15) and phospho-p53(S392) degradation in response to gamma irradiation. UBE4B plays an important role in regulating phosphorylated p53 following DNA damage.
25557723 UBE4B overexpression promotes the oncogenic properties of HCC and is correlated with an unfavorable prognosis in HCC patients.
24587254 UBE4B regulates p53 in breast cancer
24344129 We propose a model in which the coordinated action of UBE4B, ESCRT-0, and the deubiquitinating enzyme USP8 enable the endosomal sorting and lysosomal degradation of the EGFR.
22990745 UBE4B-mediated growth factor receptor trafficking may contribute to the poor prognosis of patients who have neuroblastoma tumors with 1p36 deletions.
22174917 The regulated expression of these UFD2a isoforms most likely imparts divergent functions that are important for myogenesis.
22124266 we found somatic mutations of HERC2, HERC3, TRIP12, UBE2Q1 and UBE4B genes in gastric carcinoma and colorectal carcinomas with microsatellite instability
21317885 data indicate that amplification and overexpression of UBE4B represent previously undescribed molecular mechanisms of inactivation of p53 in brain tumors
20696396 determined structures of E4B U box free and bound to UbcH5c and Ubc4 E2s; findings show E4B U box is a monomer stabilized by a network of hydrogen bonds; findings suggest allosteric regulation of UbcH5c and Ubc4 by E4B U box
20676096 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MEELSADEIRRRRLARLAGGQTSQPTTPLTSPQRENPPGPPIAASAPGPSQSLGLNVHNMTPATSPIGAS      1 - 70
GVAHRSQSSEGVSSLSSSPSNSLETQSQSLSRSQSMDIDGVSCEKSMSQVDVDSGIENMEVDENDRREKR     71 - 140
SLSDKEPSSGPEVSEEQALQLVCKIFRVSWKDRDRDVIFLSSLSAQFKQNPKEVFSDFKDLIGQILMEVL    141 - 210
MMSTQTRDENPFASLTATSQPIAAAARSPDRNLLLNTGSNPGTSPMFCSVASFGASSLSSLYESSPAPTP    211 - 280
SFWSSVPVMGPSLASPSRAASQLAVPSTPLSPHSAASGTAAGSQPSSPRYRPYTVTHPWASSGVSILSSS    281 - 350
PSPPALASSPQAVPASSSRQRPSSTGPPLPPASPSATSRRPSSLRISPSLGASGGASNWDSYSDHFTIET    351 - 420
CKETDMLNYLIECFDRVGIEEKKAPKMCSQPAVSQLLSNIRSQCISHTALVLQGSLTQPRSLQQPSFLVP    421 - 490
YMLCRNLPYGFIQELVRTTHQDEEVFKQIFIPILQGLALAAKECSLDSDYFKYPLMALGELCETKFGKTH    491 - 560
PVCNLVASLRLWLPKSLSPGCGRELQRLSYLGAFFSFSVFAEDDVKVVEKYFSGPAITLENTRVVSQSLQ    561 - 630
HYLELGRQELFKILHSILLNGETREAALSYMAAVVNANMKKAQMQTDDRLVSTDGFMLNFLWVLQQLSTK    631 - 700
IKLETVDPTYIFHPRCRITLPNDETRVNATMEDVNDWLTELYGDQPPFSEPKFPTECFFLTLHAHHLSIL    701 - 770
PSCRRYIRRLRAIRELNRTVEDLKNNESQWKDSPLATRHREMLKRCKTQLKKLVRCKACADAGLLDESFL    771 - 840
RRCLNFYGLLIQLLLRILDPAYPDITLPLNSDVPKVFAALPEFYVEDVAEFLFFIVQYSPQALYEPCTQD    841 - 910
IVMFLVVMLCNQNYIRNPYLVAKLVEVMFMTNPAVQPRTQKFFEMIENHPLSTKLLVPSLMKFYTDVEHT    911 - 980
GATSEFYDKFTIRYHISTIFKSLWQNIAHHGTFMEEFNSGKQFVRYINMLINDTTFLLDESLESLKRIHE    981 - 1050
VQEEMKNKEQWDQLPRDQQQARQSQLAQDERVSRSYLALATETVDMFHILTKQVQKPFLRPELGPRLAAM   1051 - 1120
LNFNLQQLCGPKCRDLKVENPEKYGFEPKKLLDQLTDIYLQLDCARFAKAIADDQRSYSKELFEEVISKM   1121 - 1190
RKAGIKSTIAIEKFKLLAEKVEEIVAKNARAEIDYSDAPDEFRDPLMDTLMTDPVRLPSGTIMDRSIILR   1191 - 1260
HLLNSPTDPFNRQTLTESMLEPVPELKEQIQAWMREKQNSDH                               1261 - 1302
//

Text Mined References (42)

PMID Year Title
26673821 2016 UBE4B targets phosphorylated p53 at serines 15 and 392 for degradation.
25557723 2016 Expression and prognostic role of ubiquitination factor E4B in primary hepatocellular carcinoma.
24587254 2014 Regulation of p53 level by UBE4B in breast cancer.
24344129 2014 UBE4B protein couples ubiquitination and sorting machineries to enable epidermal growth factor receptor (EGFR) degradation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23509263 2013 Activity-enhancing mutations in an E3 ubiquitin ligase identified by high-throughput mutagenesis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22990745 2013 UBE4B levels are correlated with clinical outcomes in neuroblastoma patients and with altered neuroblastoma cell proliferation and sensitivity to epidermal growth factor receptor inhibitors.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
More...