Property Summary

NCBI Gene PubMed Count 29
PubMed Score 67.42
PubTator Score 45.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis -2.900 8.5e-06
osteosarcoma -1.837 1.2e-06
atypical teratoid / rhabdoid tumor 1.100 7.7e-04
medulloblastoma, large-cell 1.600 7.4e-05
non-small cell lung cancer 1.062 7.7e-09
aldosterone-producing adenoma -1.203 7.2e-03
subependymal giant cell astrocytoma -2.103 1.4e-02
ovarian cancer -1.100 2.8e-06
pancreatic cancer -1.200 2.5e-03

Gene RIF (14)

PMID Text
26673821 UBE4B promotes endogenous phospho-p53(S15) and phospho-p53(S392) degradation in response to gamma irradiation. UBE4B plays an important role in regulating phosphorylated p53 following DNA damage.
25557723 UBE4B overexpression promotes the oncogenic properties of HCC and is correlated with an unfavorable prognosis in HCC patients.
24587254 UBE4B regulates p53 in breast cancer
24344129 We propose a model in which the coordinated action of UBE4B, ESCRT-0, and the deubiquitinating enzyme USP8 enable the endosomal sorting and lysosomal degradation of the EGFR.
22990745 UBE4B-mediated growth factor receptor trafficking may contribute to the poor prognosis of patients who have neuroblastoma tumors with 1p36 deletions.
22174917 The regulated expression of these UFD2a isoforms most likely imparts divergent functions that are important for myogenesis.
22124266 we found somatic mutations of HERC2, HERC3, TRIP12, UBE2Q1 and UBE4B genes in gastric carcinoma and colorectal carcinomas with microsatellite instability
21317885 data indicate that amplification and overexpression of UBE4B represent previously undescribed molecular mechanisms of inactivation of p53 in brain tumors
20696396 determined structures of E4B U box free and bound to UbcH5c and Ubc4 E2s; findings show E4B U box is a monomer stabilized by a network of hydrogen bonds; findings suggest allosteric regulation of UbcH5c and Ubc4 by E4B U box
20676096 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18418053 Our current study provides an insight onto the regulation of DeltaNp63alpha protein levels in response to cisplatin and also suggests that UFD2a might play an important role in the regulation of cisplatin mediated cell death mediated by p63.
16870146 we have identified a novel domain (the MPAC domain: Mitotically Phosphorylated, Apoptotically Cleaved) present at the N-terminus of Ufd2a, which is regulated both by cleavage during cell death, and by phosphorylation during mitosis.
15466860 E4B serves as a ubiquitin ligase for FEZ1 and thereby regulates its function but not its degradation
12700669 A splice site mutation was found in UBE4b. UBE4B expression was diminished in the high-stage/poor-outcome tumors.UBE4B stands out as the strongest candidate NBL tumor suppressor gene in the region at this stage.

AA Sequence

MEELSADEIRRRRLARLAGGQTSQPTTPLTSPQRENPPGPPIAASAPGPSQSLGLNVHNMTPATSPIGAS      1 - 70
GVAHRSQSSEGVSSLSSSPSNSLETQSQSLSRSQSMDIDGVSCEKSMSQVDVDSGIENMEVDENDRREKR     71 - 140
SLSDKEPSSGPEVSEEQALQLVCKIFRVSWKDRDRDVIFLSSLSAQFKQNPKEVFSDFKDLIGQILMEVL    141 - 210
MMSTQTRDENPFASLTATSQPIAAAARSPDRNLLLNTGSNPGTSPMFCSVASFGASSLSSLYESSPAPTP    211 - 280
SFWSSVPVMGPSLASPSRAASQLAVPSTPLSPHSAASGTAAGSQPSSPRYRPYTVTHPWASSGVSILSSS    281 - 350
PSPPALASSPQAVPASSSRQRPSSTGPPLPPASPSATSRRPSSLRISPSLGASGGASNWDSYSDHFTIET    351 - 420
CKETDMLNYLIECFDRVGIEEKKAPKMCSQPAVSQLLSNIRSQCISHTALVLQGSLTQPRSLQQPSFLVP    421 - 490
YMLCRNLPYGFIQELVRTTHQDEEVFKQIFIPILQGLALAAKECSLDSDYFKYPLMALGELCETKFGKTH    491 - 560
PVCNLVASLRLWLPKSLSPGCGRELQRLSYLGAFFSFSVFAEDDVKVVEKYFSGPAITLENTRVVSQSLQ    561 - 630
HYLELGRQELFKILHSILLNGETREAALSYMAAVVNANMKKAQMQTDDRLVSTDGFMLNFLWVLQQLSTK    631 - 700
IKLETVDPTYIFHPRCRITLPNDETRVNATMEDVNDWLTELYGDQPPFSEPKFPTECFFLTLHAHHLSIL    701 - 770
PSCRRYIRRLRAIRELNRTVEDLKNNESQWKDSPLATRHREMLKRCKTQLKKLVRCKACADAGLLDESFL    771 - 840
RRCLNFYGLLIQLLLRILDPAYPDITLPLNSDVPKVFAALPEFYVEDVAEFLFFIVQYSPQALYEPCTQD    841 - 910
IVMFLVVMLCNQNYIRNPYLVAKLVEVMFMTNPAVQPRTQKFFEMIENHPLSTKLLVPSLMKFYTDVEHT    911 - 980
GATSEFYDKFTIRYHISTIFKSLWQNIAHHGTFMEEFNSGKQFVRYINMLINDTTFLLDESLESLKRIHE    981 - 1050
VQEEMKNKEQWDQLPRDQQQARQSQLAQDERVSRSYLALATETVDMFHILTKQVQKPFLRPELGPRLAAM   1051 - 1120
LNFNLQQLCGPKCRDLKVENPEKYGFEPKKLLDQLTDIYLQLDCARFAKAIADDQRSYSKELFEEVISKM   1121 - 1190
RKAGIKSTIAIEKFKLLAEKVEEIVAKNARAEIDYSDAPDEFRDPLMDTLMTDPVRLPSGTIMDRSIILR   1191 - 1260
HLLNSPTDPFNRQTLTESMLEPVPELKEQIQAWMREKQNSDH                               1261 - 1302
//

Text Mined References (42)

PMID Year Title
26673821 2016 UBE4B targets phosphorylated p53 at serines 15 and 392 for degradation.
25557723 2016 Expression and prognostic role of ubiquitination factor E4B in primary hepatocellular carcinoma.
24587254 2014 Regulation of p53 level by UBE4B in breast cancer.
24344129 2014 UBE4B protein couples ubiquitination and sorting machineries to enable epidermal growth factor receptor (EGFR) degradation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23509263 2013 Activity-enhancing mutations in an E3 ubiquitin ligase identified by high-throughput mutagenesis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22990745 2013 UBE4B levels are correlated with clinical outcomes in neuroblastoma patients and with altered neuroblastoma cell proliferation and sensitivity to epidermal growth factor receptor inhibitors.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22174917 2011 A novel conserved isoform of the ubiquitin ligase UFD2a/UBE4B is expressed exclusively in mature striated muscle cells.
22124266 2011 Frameshift mutations of ubiquitination-related genes HERC2, HERC3, TRIP12, UBE2Q1 and UBE4B in gastric and colorectal carcinomas with microsatellite instability.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21317885 2011 UBE4B promotes Hdm2-mediated degradation of the tumor suppressor p53.
21269460 2011 Initial characterization of the human central proteome.
20696396 2010 Molecular basis for the association of human E4B U box ubiquitin ligase with E2-conjugating enzymes UbcH5c and Ubc4.
20676096 2010 Genome-wide association study identifies 1p36.22 as a new susceptibility locus for hepatocellular carcinoma in chronic hepatitis B virus carriers.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19805293 2009 CBP and p300 are cytoplasmic E4 polyubiquitin ligases for p53.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18418053 2008 U-box-type ubiquitin E4 ligase, UFD2a attenuates cisplatin mediated degradation of DeltaNp63alpha.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16870146 2006 The MPAC domain is a novel mitotically regulated domain, removed by apoptotic protease cleavage during cell death.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15466860 2004 Functional regulation of FEZ1 by the U-box-type ubiquitin ligase E4B contributes to neuritogenesis.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12700669 2003 Screening for gene mutations in a 500 kb neuroblastoma tumor suppressor candidate region in chromosome 1p; mutation and stage-specific expression in UBE4B/UFD2.
12504083 2003 Characterization of the mouse gene for the U-box-type ubiquitin ligase UFD2a.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11802788 2002 The human homologue of the yeast polyubiquitination factor Ufd2p is cleaved by caspase 6 and granzyme B during apoptosis.
10980605 2000 Identification and characterization of a 500-kb homozygously deleted region at 1p36.2-p36.3 in a neuroblastoma cell line.
10089879 1999 A novel ubiquitination factor, E4, is involved in multiubiquitin chain assembly.
9734811 1998 Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
9653645 1998 Molecular cloning and expression analysis of five novel genes in chromosome 1p36.