Property Summary

NCBI Gene PubMed Count 13
PubMed Score 15.04
PubTator Score 6.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 1.50225301111088E-24
adrenocortical carcinoma 1427 2.52993653555001E-8
pancreatic cancer 2300 1.60962066076369E-4
primary pancreatic ductal adenocarcinoma 1271 3.59382989057992E-4
nephrosclerosis 329 0.0110159739484356
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0233185150770323
gastric carcinoma 832 0.0324966435385323

Expression

  Differential Expression (7)

Disease log2 FC p
nephrosclerosis -1.106 0.011
adrenocortical carcinoma -1.097 0.000
primary pancreatic ductal adenocarcinoma -3.272 0.000
intraductal papillary-mucinous neoplasm ... -1.600 0.023
lung carcinoma 1.100 0.000
gastric carcinoma -2.500 0.032
pancreatic cancer -3.100 0.000

Synonym

Accession O95154 Q86SR4 Q8IVN6 Q8N5V6 Q8TAX1 Q9NUC3
Symbols AFAR2

Gene

PDB

2CLP  

  Ortholog (3)

Species Source
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
20453000 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSRQLSRARPATVLGAMEMGRRMDAPTSAAVTRAFLERGHTEIDTAFVYSEGQSETILGGLGLRLGGSDC      1 - 70
RVKIDTKAIPLFGNSLKPDSLRFQLETSLKRLQCPRVDLFYLHMPDHSTPVEETLRACHQLHQEGKFVEL     71 - 140
GLSNYAAWEVAEICTLCKSNGWILPTVYQGMYNAITRQVETELFPCLRHFGLRFYAFNPLAGGLLTGKYK    141 - 210
YEDKNGKQPVGRFFGNTWAEMYRNRYWKEHHFEGIALVEKALQAAYGASAPSMTSATLRWMYHHSQLQGA    211 - 280
HGDAVILGMSSLEQLEQNLAAAEEGPLEPAVVDAFNQAWHLVTHECPNYFR                       281 - 331
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18416522 2008 Protection against aflatoxin B1-induced cytotoxicity by expression of the cloned aflatoxin B1-aldehyde reductases rat AKR7A1 and human AKR7A3.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16341674 2005 Transcriptome analysis of human gastric cancer.
More...