Property Summary

NCBI Gene PubMed Count 13
PubMed Score 16.25
PubTator Score 6.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
adrenocortical carcinoma -1.097 2.5e-08
gastric carcinoma -2.400 4.2e-02
intraductal papillary-mucinous neoplasm ... -1.600 2.3e-02
lung carcinoma 1.100 1.5e-24
nephrosclerosis -1.106 1.1e-02
pancreatic cancer -3.100 1.6e-04
primary pancreatic ductal adenocarcinoma -3.272 3.6e-04

Gene RIF (1)

AA Sequence

MSRQLSRARPATVLGAMEMGRRMDAPTSAAVTRAFLERGHTEIDTAFVYSEGQSETILGGLGLRLGGSDC      1 - 70
RVKIDTKAIPLFGNSLKPDSLRFQLETSLKRLQCPRVDLFYLHMPDHSTPVEETLRACHQLHQEGKFVEL     71 - 140
GLSNYAAWEVAEICTLCKSNGWILPTVYQGMYNAITRQVETELFPCLRHFGLRFYAFNPLAGGLLTGKYK    141 - 210
YEDKNGKQPVGRFFGNTWAEMYRNRYWKEHHFEGIALVEKALQAAYGASAPSMTSATLRWMYHHSQLQGA    211 - 280
HGDAVILGMSSLEQLEQNLAAAEEGPLEPAVVDAFNQAWHLVTHECPNYFR                       281 - 331
//

Text Mined References (15)

PMID Year Title