Property Summary

NCBI Gene PubMed Count 126
PubMed Score 263.72
PubTator Score 169.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Common variable immunodeficiency 101

Expression

  Differential Expression (13)

Disease log2 FC p
active Crohn's disease 1.598 3.1e-02
active ulcerative colitis 1.582 2.7e-02
colon cancer 1.400 5.1e-03
cystic fibrosis 1.359 4.5e-03
intraductal papillary-mucinous adenoma (... 1.600 8.8e-03
intraductal papillary-mucinous carcinoma... 2.200 3.4e-03
intraductal papillary-mucinous neoplasm ... 2.200 9.9e-03
invasive ductal carcinoma 1.226 3.4e-02
lung cancer -1.500 2.0e-03
nasopharyngeal carcinoma 1.500 5.0e-05
pituitary cancer 1.300 1.0e-03
psoriasis 1.100 7.0e-25
tuberculosis -1.100 2.4e-02

Protein-protein Interaction (2)

Gene RIF (117)

AA Sequence

MAEDLGLSFGETASVEMLPEHGSCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLRAQGEACVQFQ      1 - 70
ALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLL     71 - 140
IPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQ    141 - 210
PIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL                                 211 - 251
//

Text Mined References (129)

PMID Year Title