Property Summary

NCBI Gene PubMed Count 113
PubMed Score 247.40
PubTator Score 169.22

Knowledge Summary


No data available




Accession O95150 Q3SX69 Q5VJK8 Q5VWH1 Q8NFE9
Symbols TL1



2O0O   2QE3   2RE9   2RJK   2RJL   3K51   3MI8  

  Ortholog (8)

Gene RIF (104)

26823868 Rs3810936 of TNFSF15 were related to the risk of ankylosing spondylitis
26810853 Biologics beyond TNF-alpha inhibitors and the effect of targeting the homologues TL1A-DR3 pathway in chronic inflammatory disorders.
26509650 TL1A-induced cell death is directly mediated through DR3.
26393680 Higher TL1A levels were associated with early stage chronic lymphocytic leukemia.
26200500 This study shows an association between TNFSF15-rs3810936 and AAU and suggests that the TL1A/DR3 pathway may be implicated in the pathogenesis of this disease.
26072972 The data indicate that TL1A may contribute to pathogenesis of inflammatory bowel diseases via local but not systemic induction of IL-17A but not IL-4, IL-13 or IFN-gamma.
26046454 Addition of TL1A to IL-1beta + IL-23 also augmented ILC3 proliferation
25929716 Plasma levels of TL1A were significantly higher in newly diagnosed SLE patients compared with controls, and were positively associated with SLE disease activity index.
25908025 TL1A blood levels are elevated in psoriasis patients; TL1A expression is higher in psoriatic lesions than in normal skin
25899471 Human primary biliary cirrhosis-susceptible allele of rs4979462 enhances TNFSF15 expression by binding NF-1.

AA Sequence

PIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL                                 211 - 251

Text Mined References (116)

PMID Year Title
26823868 2015 Genetic analysis of TNFST15 variants in ankylosing spondylitis.
26810853 2016 Biologics beyond TNF-? inhibitors and the effect of targeting the homologues TL1A-DR3 pathway in chronic inflammatory disorders.
26646413 2016 Comparative genomic analysis of eutherian tumor necrosis factor ligand genes.
26509650 2016 Soluble TL1A is sufficient for activation of death receptor 3.
26393680 2015 Expression and function of the TL1A/DR3 axis in chronic lymphocytic leukemia.
26200500 2015 Association of Genetic Variations in TNFSF15 With Acute Anterior Uveitis in Chinese Han.
26072972 2015 TL1A as a Potential Local Inducer of IL17A Expression in Colon Mucosa of Inflammatory Bowel Disease Patients.
26046454 2015 Human group3 innate lymphoid cells express DR3 and respond to TL1A with enhanced IL-22 production and IL-2-dependent proliferation.
25929716 2015 Elevated plasma levels of TL1A in newly diagnosed systemic lupus erythematosus patients.
25908025 2015 Secretion, blood levels and cutaneous expression of TL1A in psoriasis patients.