Property Summary

NCBI Gene PubMed Count 16
Grant Count 1
Funding $61,018.9
PubMed Score 18.78
PubTator Score 19.93

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O95149 A6NE34 A8K0B0 D3DW76
Symbols KPNBL
RNUT1
Snurportin1

Gene

 Grant Application (1)

PDB

2P8Q   2Q5D   2QNA   3LWW   3GJX   3NBY   3NBZ   3NC0   5DIS   3GB8   1XK5  

Gene RIF (6)

PMID Text
26866982 Results show that marker rs218966 in gene PHF14 and rs9836027 in MAP4 significantly associated with hypertension; additionally, rare variants in SNUPN significantly associated with systolic blood pressure.
24722547 analysis of interactions between CRM1 and the nuclear pore protein Tpr and snurportin
19619473 the binding of dimethylated RNA-caps to snurportin 1
19389996 study presents the crystal structure of the SPN1.CRM1.RanGTP export complex at 2.5 angstrom resolution (where SPN1 is snurportin1 and RanGTP is guanosine 5' triphosphate-bound Ran
16030253 There is an interaction between the N- and C-terminal domains of SPN, suggesting an autoregulatory function similar to that of importin-alpha.
12095920 SPN construct lacking the importin beta binding domain (IBB) localizes primarily to the nucleus rather than to the cytoplasm.

AA Sequence

MEELSQALASSFSVSQDLNSTAAPHPRLSQYKSKYSSLEQSERRRRLLELQKSKRLDYVNHARRLAEDDW      1 - 70
TGMESEEENKKDDEEMDIDTVKKLPKHYANQLMLSEWLIDVPSDLGQEWIVVVCPVGKRALIVASRGSTS     71 - 140
AYTKSGYCVNRFSSLLPGGNRRNSTAKDYTILDCIYNEVNQTYYVLDVMCWRGHPFYDCQTDFRFYWMHS    141 - 210
KLPEEEGLGEKTKLNPFKFVGLKNFPCTPESLCDVLSMDFPFEVDGLLFYHKQTHYSPGSTPLVGWLRPY    211 - 280
MVSDVLGVAVPAGPLTTKPDYAGHQLQQIMEHKKSQKEGMKEKLTHKASENGHYELEHLSTPKLKGSSHS    281 - 350
PDHPGCLMEN                                                                351 - 360
//

Text Mined References (23)

PMID Year Title
26866982 2016 Filtering genetic variants and placing informative priors based on putative biological function.
24722547 2014 The interaction of CRM1 and the nuclear pore protein Tpr.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20476751 2010 Conformational selection in the recognition of the snurportin importin beta binding domain by importin beta.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19619473 2009 Molecular determinants of snurportin 1 ligand affinity and structural response upon binding.
19389996 2009 Crystal structure of the nuclear export receptor CRM1 in complex with Snurportin1 and RanGTP.
More...