Property Summary

NCBI Gene PubMed Count 15
Grant Count 10
R01 Count 10
Funding $450,469.57
PubMed Score 13.17
PubTator Score 6.60

Knowledge Summary

Patent

No data available

Gene RIF (7)

PMID Text
26891723 levels significantly decreased in failing hearts
26521044 these findings reveal a novel mechanism by which TRAF2 mediates Lys63-linked ubiquitination of DUSP14, leading to DUSP14 activation in T cells
23229544 findings suggest that DUSP14 negatively regulates TNF- or IL-1-induced NF-kappaB activation by dephosphorylating TAK1 at Thr-187
22233810 DUSP14 may be a susceptibility gene for pulmonary tuberculosis.
19770498 The overproduction, purification and crystal structure at 1.88 A resolution of human dual-specificity phosphatase 14, DUSP14 (MKP6), are reported.
18201568 The binding of Lipomannan to TLR2 triggers MAPK activation, followed by an up-regulation of MKP-1 expression, which in turn may act as a negative regulator of MAPK activation.
17178844 Activation of ATM by radiation down-regulates phospho-ERK1/2 and its downstream signaling via increased expression of mitogen-activated protein kinase phosphatase MKP-1.

AA Sequence

MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQ      1 - 70
FEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNW     71 - 140
VKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPYWGI                141 - 198
//

Text Mined References (16)

PMID Year Title
26891723 2016 Dual-specificity phosphatase 14 protects the heart from aortic banding-induced cardiac hypertrophy and dysfunction through inactivation of TAK1-P38MAPK/-JNK1/2 signaling pathway.
26521044 2016 TRAF2-mediated Lys63-linked ubiquitination of DUSP14/MKP6 is essential for its phosphatase activity.
25416956 2014 A proteome-scale map of the human interactome network.
23535730 2013 GWAS meta-analysis and replication identifies three new susceptibility loci for ovarian cancer.
23229544 2013 The dual-specificity phosphatase DUSP14 negatively regulates tumor necrosis factor- and interleukin-1-induced nuclear factor-?B activation by dephosphorylating the protein kinase TAK1.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22233810 2012 Deciphering the genetic architecture of variation in the immune response to Mycobacterium tuberculosis infection.
20694014 2010 Genome-wide association analyses identifies a susceptibility locus for tuberculosis on chromosome 18q11.2.
19770498 2009 Overproduction, purification and structure determination of human dual-specificity phosphatase 14.
19228121 2009 Dual-specificity phosphatases: critical regulators with diverse cellular targets.
More...