Property Summary

NCBI Gene PubMed Count 25
Grant Count 4
Funding $58,031.75
PubMed Score 6.49
PubTator Score 133.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.158 0.002
psoriasis 1.900 0.000
osteosarcoma 1.515 0.001
pancreatic ductal adenocarcinoma liver m... -1.340 0.004
acute myeloid leukemia -1.100 0.004

Synonym

Accession O95139 A8K0Y7 Q5VYT2 Q6IB84
Symbols CI
B17

Gene

Gene RIF (8)

PMID Text
25902503 NDUFS6 has a Zn-binding site and is essential for biogenesis of mitochondrial complex I
25315157 we propose that NDUFB6 is a possible tumor suppressor of metastatic ccRCCs.
21964293 NDUFB6 subunit is required for complex I activity.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19265027 Polymorphism in the NDUFB6 gene from respiratory chain complex I related to ATP synthesis and insulin sensitivity response to exercise training found in relatives of humans with type 2 diabetes.
19265027 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19064571 Observational study of gene-disease association. (HuGE Navigator)
17948130 Results demonstrate that genetic, epigenetic, and nongenetic factors associate with NDUFB6 expression in human muscle and suggest that genetic and epigenetic factors may interact to increase age-dependent susceptibility to insulin resistance.

AA Sequence

MTGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKMVHGVYKKSIF      1 - 70
VFTHVLVPVWIIHYYMKYHVSEKPYGIVEKKSRIFPGDTILETGEVIPPMKEFPDQHH                 71 - 128
//

Text Mined References (28)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25902503 2015 Accessory NUMM (NDUFS6) subunit harbors a Zn-binding site and is essential for biogenesis of mitochondrial complex I.
25315157 2015 Downregulation of NDUFB6 due to 9p24.1-p13.3 loss is implicated in metastatic clear cell renal cell carcinoma.
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
21964293 2011 The NDUFB6 subunit of the mitochondrial respiratory chain complex I is required for electron transfer activity: a proof of principle study on stable and controlled RNA interference in human cell lines.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19265027 2009 Short-term exercise training does not stimulate skeletal muscle ATP synthesis in relatives of humans with type 2 diabetes.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
More...