Property Summary

NCBI Gene PubMed Count 61
Grant Count 87
R01 Count 58
Funding $7,109,180.97
PubMed Score 174.27
PubTator Score 82.80

Knowledge Summary

Patent (14,776)

TINX Plot

  Disease Relevance (3)

Expression

Synonym

Accession O95136 Q86UN8 S1P receptor 2
Symbols EDG5
H218
LPB2
S1P2
AGR16
EDG-5
DFNB68
Gpcr13

Gene

PANTHER Protein Class (2)

PDB

1ZTI  

  TechDev Info (1)

MLP Assay (15)

AID Type Active / Inconclusive / Inactive Description
729 screening 447 / 0 / 96442 Primary Cell-Based High-Throughput Screening to Identify Agonists of the Sphingosine 1-phosphate receptor 2 (S1P2)
736 screening 207 / 0 / 96682 Primary Cell-Based High-Throughput Screening to Identify Antagonists of the Sphingosine 1-phosphate receptor 2 (S1P2)
843 confirmatory 16 / 0 / 47 Counter screen for S1P2 Agonists: Dose Response High Throughput Cell-Based Screen to Identify Activators of CRE-BLA
851 confirmatory 55 / 0 / 27 Dose Response Cell Based Assay for Antagonists of the S1P2 Receptor
856 confirmatory 55 / 0 / 27 Counterscreen for S1P2 Antagonists: Dose Response Cell-Based Screen to Identify Antagonists of CRE-BLA
872 confirmatory 2 / 0 / 57 Dose Response Cell Based Assay for Agonists of the S1P2 Receptor of Purchased Analogues
874 confirmatory 0 / 0 / 59 Counterscreen for S1P2 Agonists: Dose Response High Throughput Cell-Based Screen to Identify Activators of CRE-BLA: S1P2 Purchased Analogues
1232 confirmatory 0 / 0 / 10 Dose Response Cell-Based Assay for Agonists of the Sphingosine 1-Phosphate Receptor 2 (S1P2): Purchased Analogues
1657 summary 0 / 0 / 0 Summary of probe development efforts to identify antagonists of Sphingosine 1-Phosphate Receptor 2 (S1P2)
1801 summary 2 / 0 / 0 Summary of probe development efforts to identify agonists of Sphingosine 1-Phosphate Receptor 4 (S1P4)
More...

Gene RIF (43)

PMID Text
26729899 S1PR2 is repressed by FOXP1 in activated B-cell and germinal center B-cell DLBCL cell lines with aberrantly high FOXP1 levels; S1PR2 expression is further inversely correlated with FOXP1 expression in 3 DLBCL patient cohorts.
26669941 LXR-alpha might downregulate S1PR2 expression via miR-130a-3p in quiescent HUVECs. Stimulation of TNF-alpha attenuates the activity of LXR-alpha and results in enhanced S1PR2 expression.
26631556 S1PR2 mediates Rho activation in normal cells neighboring RasV12-transformed cells.
26518876 S1PR2 plays a critical role in TCA-induced COX-2 expression and CCA growth and may represent a novel therapeutic target for CCA.
26321412 Sphingosine 1-phosphate-induced IL-8 gene expression is mainly regulated via S1PR(1), and its secretion is regulated through S1PR(2) receptor subtype.
26243335 be detected in the human cerebrovascular endothelium
26105954 AB1 displayed potency at least equivalent to JTE-013 in affecting signaling molecules downstream of S1P2.
25673082 both S1PR1 and S1PR2 play a pivotal role in hyperglycemia-induced EC dysfunction and endothelial injury by reducing and enhancing the production of oxidative stress.
25557733 Activation of S1PR2-calcium influx-RhoA/ROCK dominates the high-dose S1P-induced endothelial monolayer hyperpermeability response.
24903384 Data show that sphingosine kinase SphK1 and sphingosine-1-phosphate (S1P) receptors S1P1, S1P2, S1P3, and S1P5 were expressed from primary, up to recurrent and secondary glioblastomas, with sphingosine kinase SphK2 levels were highest in primary tumors.
More...

AA Sequence

MGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVENLLVLIAVARNSKFHSAMYL      1 - 70
FLGNLAASDLLAGVAFVANTLLSGSVTLRLTPVQWFAREGSAFITLSASVFSLLAIAIERHVAIAKVKLY     71 - 140
GSDKSCRMLLLIGASWLISLVLGGLPILGWNCLGHLEACSTVLPLYAKHYVLCVVTIFSIILLAIVALYV    141 - 210
RIYCVVRSSHADMAAPQTLALLKTVTIVLGVFIVCWLPAFSILLLDYACPVHSCPILYKAHYFFAVSTLN    211 - 280
SLLNPVIYTWRSRDLRREVLRPLQCWRPGVGVQGRRRGGTPGHHLLPLRSSSSLERGMHMPTSPTFLEGN    281 - 350
TVV                                                                       351 - 353
//

Text Mined References (61)

PMID Year Title
26805784 2016 Autosomal-Recessive Hearing Impairment Due to Rare Missense Variants within S1PR2.
26729899 2016 The hematopoietic oncoprotein FOXP1 promotes tumor cell survival in diffuse large B-cell lymphoma by repressing S1PR2 signaling.
26669941 2016 Liver X receptor-? and miR-130a-3p regulate expression of sphingosine 1-phosphate receptor 2 in human umbilical vein endothelial cells.
26631556 2016 A role of the sphingosine-1-phosphate (S1P)-S1P receptor 2 pathway in epithelial defense against cancer (EDAC).
26518876 2015 Taurocholate Induces Cyclooxygenase-2 Expression via the Sphingosine 1-phosphate Receptor 2 in a Human Cholangiocarcinoma Cell Line.
26321412 2015 Sphingosine 1-phosphate regulates IL-8 expression and secretion via S1PR1 and S1PR2 receptors-mediated signaling in extravillous trophoblast derived HTR-8/SVneo cells.
26243335 2015 Critical role of sphingosine-1-phosphate receptor-2 in the disruption of cerebrovascular integrity in experimental stroke.
26209696 2015 Intracellular sphingosine kinase 2-derived sphingosine-1-phosphate mediates epidermal growth factor-induced ezrin-radixin-moesin phosphorylation and cancer cell invasion.
26105954 2015 Antitumor Activity of a Novel Sphingosine-1-Phosphate 2 Antagonist, AB1, in Neuroblastoma.
25673082 2015 Role of sphingosine-1-phosphate receptor 1 and sphingosine-1-phosphate receptor 2 in hyperglycemia-induced endothelial cell dysfunction.
More...