Property Summary

Ligand Count 94
NCBI Gene PubMed Count 64
PubMed Score 191.00
PubTator Score 82.80

Knowledge Summary

Patent (14,776)

Expression

Gene RIF (45)

AA Sequence

MGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVENLLVLIAVARNSKFHSAMYL      1 - 70
FLGNLAASDLLAGVAFVANTLLSGSVTLRLTPVQWFAREGSAFITLSASVFSLLAIAIERHVAIAKVKLY     71 - 140
GSDKSCRMLLLIGASWLISLVLGGLPILGWNCLGHLEACSTVLPLYAKHYVLCVVTIFSIILLAIVALYV    141 - 210
RIYCVVRSSHADMAAPQTLALLKTVTIVLGVFIVCWLPAFSILLLDYACPVHSCPILYKAHYFFAVSTLN    211 - 280
SLLNPVIYTWRSRDLRREVLRPLQCWRPGVGVQGRRRGGTPGHHLLPLRSSSSLERGMHMPTSPTFLEGN    281 - 350
TVV                                                                       351 - 353
//

Text Mined References (64)

PMID Year Title