Property Summary

NCBI Gene PubMed Count 19
PubMed Score 12.86
PubTator Score 17.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.700 0.000
psoriasis -1.600 0.000
osteosarcoma -1.431 0.000
lung cancer 1.700 0.000
group 3 medulloblastoma 1.300 0.000

Gene RIF (12)

PMID Text
22944692 Positional proteomics analysis identifies the cleavage of human zinc finger protein 202 (ZNF202) at amino acid residues 68-69 by the HIV-1 protease
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19875103 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19336475 Observational study of gene-disease association. (HuGE Navigator)
18652945 Homozygosity for a common functional promoter variant in ZNF202 predicts severe atherosclerosis and an increased risk of IHD.
18523156 SOX17-Chromatin immunoprecipitation identified zinc finger protein 202 (Zfp202) as a direct target of SOX17 during endoderm differentiation of F9 embryonal carcinoma cells.
16467280 Observational study of gene-disease association. (HuGE Navigator)
16467280 findings show that genetic variation in ZNF202 is common in the general population. However, SNPs in the protein-coding region of ZNF202 do not make a major contribution to HDL cholesterol levels.
16415175 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MATAVEPEDQDLWEEEGILMVKLEDDFTCRPESVLQRDDPVLETSHQNFRRFRYQEAASPREALIRLREL      1 - 70
CHQWLRPERRTKEQILELLVLEQFLTVLPGELQSWVRGQRPESGEEAVTLVEGLQKQPRRPRRWVTVHVH     71 - 140
GQEVLSEETVHLGVEPESPNELQDPVQSSTPEQSPEETTQSPDLGAPAEQRPHQEEELQTLQESEVPVPE    141 - 210
DPDLPAERSSGDSEMVALLTALSQGLVTFKDVAVCFSQDQWSDLDPTQKEFYGEYVLEEDCGIVVSLSFP    211 - 280
IPRPDEISQVREEEPWVPDIQEPQETQEPEILSFTYTGDRSKDEEECLEQEDLSLEDIHRPVLGEPEIHQ    281 - 350
TPDWEIVFEDNPGRLNERRFGTNISQVNSFVNLRETTPVHPLLGRHHDCSVCGKSFTCNSHLVRHLRTHT    351 - 420
GEKPYKCMECGKSYTRSSHLARHQKVHKMNAPYKYPLNRKNLEETSPVTQAERTPSVEKPYRCDDCGKHF    421 - 490
RWTSDLVRHQRTHTGEKPFFCTICGKSFSQKSVLTTHQRIHLGGKPYLCGECGEDFSEHRRYLAHRKTHA    491 - 560
AEELYLCSECGRCFTHSAAFAKHLRGHASVRPCRCNECGKSFSRRDHLVRHQRTHTGEKPFTCPTCGKSF    561 - 630
SRGYHLIRHQRTHSEKTS                                                        631 - 648
//

Text Mined References (22)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19875103 2010 Genomewide association study of movement-related adverse antipsychotic effects.
19336475 2009 Integrated associations of genotypes with multiple blood biomarkers linked to coronary heart disease risk.
18652945 2008 Functional promoter variant in zinc finger protein 202 predicts severe atherosclerosis and ischemic heart disease.
18523156 2008 SOX17 directly activates Zfp202 transcription during in vitro endoderm differentiation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...