Property Summary

NCBI Gene PubMed Count 19
PubMed Score 13.00
PubTator Score 17.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
malignant mesothelioma 3232 2.5e-07
group 3 medulloblastoma 4104 1.1e-05
osteosarcoma 7950 5.6e-05
psoriasis 6694 1.2e-04
lung cancer 4740 4.5e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 1.300 1.1e-05
lung cancer 1.700 4.5e-04
malignant mesothelioma 1.700 2.5e-07
osteosarcoma -1.431 5.6e-05
psoriasis -1.600 1.2e-04

Protein-protein Interaction (5)

Gene RIF (12)

AA Sequence

MATAVEPEDQDLWEEEGILMVKLEDDFTCRPESVLQRDDPVLETSHQNFRRFRYQEAASPREALIRLREL      1 - 70
CHQWLRPERRTKEQILELLVLEQFLTVLPGELQSWVRGQRPESGEEAVTLVEGLQKQPRRPRRWVTVHVH     71 - 140
GQEVLSEETVHLGVEPESPNELQDPVQSSTPEQSPEETTQSPDLGAPAEQRPHQEEELQTLQESEVPVPE    141 - 210
DPDLPAERSSGDSEMVALLTALSQGLVTFKDVAVCFSQDQWSDLDPTQKEFYGEYVLEEDCGIVVSLSFP    211 - 280
IPRPDEISQVREEEPWVPDIQEPQETQEPEILSFTYTGDRSKDEEECLEQEDLSLEDIHRPVLGEPEIHQ    281 - 350
TPDWEIVFEDNPGRLNERRFGTNISQVNSFVNLRETTPVHPLLGRHHDCSVCGKSFTCNSHLVRHLRTHT    351 - 420
GEKPYKCMECGKSYTRSSHLARHQKVHKMNAPYKYPLNRKNLEETSPVTQAERTPSVEKPYRCDDCGKHF    421 - 490
RWTSDLVRHQRTHTGEKPFFCTICGKSFSQKSVLTTHQRIHLGGKPYLCGECGEDFSEHRRYLAHRKTHA    491 - 560
AEELYLCSECGRCFTHSAAFAKHLRGHASVRPCRCNECGKSFSRRDHLVRHQRTHTGEKPFTCPTCGKSF    561 - 630
SRGYHLIRHQRTHSEKTS                                                        631 - 648
//

Text Mined References (23)

PMID Year Title