Property Summary

NCBI Gene PubMed Count 23
Grant Count 103
R01 Count 54
Funding $7,799,775.75
PubMed Score 99.39
PubTator Score 52.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma 2.100 0.000
oligodendroglioma 1.100 0.000
posterior fossa group A ependymoma -2.500 0.000
glioblastoma 1.700 0.007
group 4 medulloblastoma -3.700 0.000
atypical teratoid/rhabdoid tumor -3.100 0.000
medulloblastoma, large-cell -3.400 0.000
adult high grade glioma 1.100 0.024
pilocytic astrocytoma 2.600 0.000
spina bifida 1.034 0.040
pituitary cancer -6.300 0.000
Down syndrome 1.300 0.002

Synonym

Accession O95096
Symbols NKX2B
NKX2.2

Gene

 GO Component (1)

Gene RIF (12)

PMID Text
24982138 lentiviral overexpression of transcription factors ASCL1, SOX10, and NKX2.2 in NPCs was sufficient to induce Sox10 enhancer activity, OPC mRNA, and protein expression consistent with OPC fate
24821492 Our study suggests that CGT expression is controlled by balanced expression of the negative modulator OLIG2 and positive regulator Nkx2.2, providing new insights into how expression of GalCer is tightly regulated in cell-type- and stage-specific manners.
24411943 NKX2-2 and MNX1 are etiological genes for neonatal diabetes.
22446943 NKX2.2 is a valuable marker for Ewing sarcoma, with a sensitivity of 93% and a specificity of 89%, and aids in the differential diagnosis of small round cell tumors.
21624811 The NKX2-2 can induce desired neuronal lineages from most expressing neural progenitor cells by a mechanism resembling developmental binary cell-fate switching.
21481790 NKX2-1, NKX2-2, and MEF2C define oncogenic pathways in T cell acute lymphoblastic leukemia (T-ALL).
20599218 expression may assist in the determination of the primary tumor site in patients with neuroendocrine tumor metastases of unknown origin: negative would suggest a bronchopulmonary primary, whereas positive would suggest a gastrointestinal primary
19011242 several genes that are known to be regulated by DNA methylation were up-regulated dramatically by integrin alpha6beta4 expression, including S100A4, FST, PDLIM4, CAPG, and Nkx2.2.
18987169 NKX2.2 functions in immature endocrine cells to control neuroendocrine differentiation in normal intestine and is expressed in most neuroendocrine tumors of the gut
18414662 EWS/FLI mediates transcriptional repression via NKX2.2 during oncogenic transformation in Ewing's sarcoma
More...

AA Sequence

MSLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQGALDAVQSLPLKNPFYDSSD      1 - 70
NPYTRWLASTEGLQYSLHGLAAGAPPQDSSSKSPEPSADESPDNDKETPGGGGDAGKKRKRRVLFSKAQT     71 - 140
YELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTPLPSPRRVAVPVLVR    141 - 210
DGKPCHALKAQDLAAATFQAGIPFSAYSAQSLQHMQYNAQYSSASTPQYPTAHPLVQAQQWTW           211 - 273
//

Text Mined References (23)

PMID Year Title
24982138 2014 Transcription factor induction of human oligodendrocyte progenitor fate and differentiation.
24925725 2014 Lupus nephritis susceptibility loci in women with systemic lupus erythematosus.
24821492 2014 Ceramide galactosyltransferase expression is regulated positively by Nkx2.2 and negatively by OLIG2.
24411943 2014 Analysis of transcription factors key for mouse pancreatic development establishes NKX2-2 and MNX1 mutations as causes of neonatal diabetes in man.
22446943 2012 NKX2.2 is a useful immunohistochemical marker for Ewing sarcoma.
21624811 2011 Transcription factor-induced lineage selection of stem-cell-derived neural progenitor cells.
21481790 2011 Integrated transcript and genome analyses reveal NKX2-1 and MEF2C as potential oncogenes in T cell acute lymphoblastic leukemia.
20599218 2010 Lack of NKX2.2 expression in bronchopulmonary typical carcinoid tumors: implications for patients with neuroendocrine tumor metastases and unknown primary site.
19011242 2009 Integrin alpha6beta4 controls the expression of genes associated with cell motility, invasion, and metastasis, including S100A4/metastasin.
18987169 2009 Homeodomain transcription factor NKX2.2 functions in immature cells to control enteroendocrine differentiation and is expressed in gastrointestinal neuroendocrine tumors.
More...