Property Summary

NCBI Gene PubMed Count 25
PubMed Score 107.98
PubTator Score 52.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma 1.100 2.4e-02
Astrocytoma, Pilocytic 2.600 3.7e-06
atypical teratoid / rhabdoid tumor -2.700 1.4e-06
Down syndrome 1.300 1.5e-03
ependymoma -2.200 1.3e-04
glioblastoma 1.700 6.7e-03
group 3 medulloblastoma -3.500 2.7e-06
malignant mesothelioma 2.100 8.6e-07
medulloblastoma, large-cell -3.400 8.2e-08
oligodendroglioma 1.100 7.1e-06
pituitary cancer -6.300 5.3e-18
spina bifida 1.034 4.0e-02

 GO Component (1)

Gene RIF (14)

AA Sequence

MSLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQGALDAVQSLPLKNPFYDSSD      1 - 70
NPYTRWLASTEGLQYSLHGLAAGAPPQDSSSKSPEPSADESPDNDKETPGGGGDAGKKRKRRVLFSKAQT     71 - 140
YELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTPLPSPRRVAVPVLVR    141 - 210
DGKPCHALKAQDLAAATFQAGIPFSAYSAQSLQHMQYNAQYSSASTPQYPTAHPLVQAQQWTW           211 - 273
//

Text Mined References (25)

PMID Year Title