Property Summary

NCBI Gene PubMed Count 20
PubMed Score 4.65
PubTator Score 3.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
active Crohn's disease -1.386 8.3e-03
active ulcerative colitis -1.182 1.6e-02
adrenocortical carcinoma 1.176 9.6e-04
adult high grade glioma 1.300 6.3e-03
Astrocytoma, Pilocytic 2.800 1.7e-11
atypical teratoid / rhabdoid tumor 1.100 1.9e-02
Breast cancer 3.200 2.4e-02
Common variable immunodeficiency 1.096 1.1e-02
cutaneous lupus erythematosus 1.500 7.3e-04
cystic fibrosis -1.396 3.7e-06
esophageal adenocarcinoma 1.500 4.3e-02
fibroadenoma 1.200 2.3e-03
glioblastoma 1.300 9.9e-04
group 3 medulloblastoma 1.200 8.5e-03
head and neck cancer -1.100 2.7e-02
head and neck cancer and chronic obstruc... -1.100 5.3e-03
intraductal papillary-mucinous carcinoma... -1.100 3.2e-02
invasive ductal carcinoma 1.388 1.4e-03
nasopharyngeal carcinoma -1.900 2.1e-07
oligodendroglioma -1.100 3.9e-02
ovarian cancer -1.300 2.5e-02
pancreatic cancer 1.900 5.2e-04
posterior fossa group A ependymoma 1.800 2.2e-07
primary pancreatic ductal adenocarcinoma 2.414 6.9e-04
psoriasis 1.400 7.0e-04
subependymal giant cell astrocytoma 3.898 1.3e-02
tuberculosis 1.200 1.1e-03
type I diabetes mellitus -1.269 1.3e-02

Protein-protein Interaction (3)

Gene RIF (2)

AA Sequence

MAGIPGLLFLLFFLLCAVGQVSPYSAPWKPTWPAYRLPVVLPQSTLNLAKPDFGAEAKLEVSSSCGPQCH      1 - 70
KGTPLPTYEEAKQYLSYETLYANGSRTETQVGIYILSSSGDGAQHRDSGSSGKSRRKRQIYGYDSRFSIF     71 - 140
GKDFLLNYPFSTSVKLSTGCTGTLVAEKHVLTAAHCIHDGKTYVKGTQKLRVGFLKPKFKDGGRGANDST    141 - 210
SAMPEQMKFQWIRVKRTHVPKGWIKGNANDIGMDYDYALLELKKPHKRKFMKIGVSPPAKQLPGGRIHFS    211 - 280
GYDNDRPGNLVYRFCDVKDETYDLLYQQCDAQPGASGSGVYVRMWKRQQQKWERKIIGIFSGHQWVDMNG    281 - 350
SPQDFNVAVRITPLKYAQICYWIKGNYLDCREG                                         351 - 383
//

Text Mined References (23)

PMID Year Title