Property Summary

NCBI Gene PubMed Count 20
PubMed Score 4.49
PubTator Score 3.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O95084 B2RDJ1 B4E2J3 Q6IBI0
Symbols SIG13
SPUVE
ZSIG13

Gene

Gene RIF (2)

PMID Text
22291950 PRSS23 might be a critical component of estrogen-mediated cell proliferation of ERalpha-positive breast cancer cells.
20532202 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MAGIPGLLFLLFFLLCAVGQVSPYSAPWKPTWPAYRLPVVLPQSTLNLAKPDFGAEAKLEVSSSCGPQCH      1 - 70
KGTPLPTYEEAKQYLSYETLYANGSRTETQVGIYILSSSGDGAQHRDSGSSGKSRRKRQIYGYDSRFSIF     71 - 140
GKDFLLNYPFSTSVKLSTGCTGTLVAEKHVLTAAHCIHDGKTYVKGTQKLRVGFLKPKFKDGGRGANDST    141 - 210
SAMPEQMKFQWIRVKRTHVPKGWIKGNANDIGMDYDYALLELKKPHKRKFMKIGVSPPAKQLPGGRIHFS    211 - 280
GYDNDRPGNLVYRFCDVKDETYDLLYQQCDAQPGASGSGVYVRMWKRQQQKWERKIIGIFSGHQWVDMNG    281 - 350
SPQDFNVAVRITPLKYAQICYWIKGNYLDCREG                                         351 - 383
//

Text Mined References (23)

PMID Year Title
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23353556 2013 Identification of human epididymis protein-4 as a fibroblast-derived mediator of fibrosis.
22291950 2012 Serine protease PRSS23 is upregulated by estrogen receptor ? and associated with proliferation of breast cancer cells.
20532202 2010 Use of genome-wide expression data to mine the "Gray Zone" of GWA studies leads to novel candidate obesity genes.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
16870946 2006 The identification of novel ovarian proteases through the use of genomic and bioinformatic methodologies.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
More...