Property Summary

NCBI Gene PubMed Count 20
PubMed Score 4.49
PubTator Score 3.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Melanoma 261
Disease Target Count P-value
pilocytic astrocytoma 3086 1.6428103636645E-11
posterior fossa group A ependymoma 1511 1.22155956431863E-7
nasopharyngeal carcinoma 1056 8.24070277960841E-7
ulcerative colitis 2087 2.36766368307717E-6
cystic fibrosis 1670 2.10790209563894E-5
pediatric high grade glioma 2712 3.63956931185381E-4
ovarian cancer 8492 6.41511166487641E-4
primary pancreatic ductal adenocarcinoma 1271 6.94753893064509E-4
psoriasis 6685 7.03337559189876E-4
cutaneous lupus erythematosus 1056 7.3091307562192E-4
adrenocortical carcinoma 1427 9.60294046334422E-4
invasive ductal carcinoma 2950 0.00144618273198625
pancreatic cancer 2300 0.00211426800681427
fibroadenoma 557 0.00230427224404654
head and neck cancer and chronic obstructive pulmonary disease 237 0.00527521128839176
tuberculosis and treatment for 3 months 327 0.00570523502251431
glioblastoma 5572 0.00763104624768021
active Crohn's disease 918 0.00833812576895921
group 3 medulloblastoma 2254 0.00853644318128869
Common variable immunodeficiency 98 0.0111986219078709
type I diabetes mellitus 22 0.0126900061770955
subependymal giant cell astrocytoma 2287 0.0132716380072578
atypical teratoid / rhabdoid tumor 4369 0.01890465218162
Breast cancer 3099 0.0242437391459974
head and neck cancer 270 0.026615193384219
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.031907734138196
oligodendroglioma 2849 0.0393331450590794
esophageal adenocarcinoma 737 0.0430514290079408

Expression

Synonym

Accession O95084 B2RDJ1 B4E2J3 Q6IBI0
Symbols SIG13
SPUVE
ZSIG13

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Pathway (1)

Gene RIF (2)

PMID Text
22291950 PRSS23 might be a critical component of estrogen-mediated cell proliferation of ERalpha-positive breast cancer cells.
20532202 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MAGIPGLLFLLFFLLCAVGQVSPYSAPWKPTWPAYRLPVVLPQSTLNLAKPDFGAEAKLEVSSSCGPQCH      1 - 70
KGTPLPTYEEAKQYLSYETLYANGSRTETQVGIYILSSSGDGAQHRDSGSSGKSRRKRQIYGYDSRFSIF     71 - 140
GKDFLLNYPFSTSVKLSTGCTGTLVAEKHVLTAAHCIHDGKTYVKGTQKLRVGFLKPKFKDGGRGANDST    141 - 210
SAMPEQMKFQWIRVKRTHVPKGWIKGNANDIGMDYDYALLELKKPHKRKFMKIGVSPPAKQLPGGRIHFS    211 - 280
GYDNDRPGNLVYRFCDVKDETYDLLYQQCDAQPGASGSGVYVRMWKRQQQKWERKIIGIFSGHQWVDMNG    281 - 350
SPQDFNVAVRITPLKYAQICYWIKGNYLDCREG                                         351 - 383
//

Text Mined References (23)

PMID Year Title
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23353556 2013 Identification of human epididymis protein-4 as a fibroblast-derived mediator of fibrosis.
22291950 2012 Serine protease PRSS23 is upregulated by estrogen receptor ? and associated with proliferation of breast cancer cells.
20532202 2010 Use of genome-wide expression data to mine the "Gray Zone" of GWA studies leads to novel candidate obesity genes.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
16870946 2006 The identification of novel ovarian proteases through the use of genomic and bioinformatic methodologies.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
More...