Property Summary

NCBI Gene PubMed Count 10
PubMed Score 13.37
PubTator Score 25.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 1.2e-04
colon cancer -1.400 1.6e-03
cutaneous lupus erythematosus -1.600 5.4e-03
esophageal adenocarcinoma -1.300 3.2e-02
group 3 medulloblastoma -1.100 1.6e-02
intraductal papillary-mucinous neoplasm ... 1.400 5.7e-04
lung cancer -1.200 2.2e-02
malignant mesothelioma 1.100 1.9e-06
medulloblastoma, large-cell -1.800 1.2e-06
osteosarcoma 1.692 4.3e-07
ovarian cancer -1.100 3.9e-04
pancreatic ductal adenocarcinoma liver m... -1.236 1.4e-02
primary Sjogren syndrome -1.100 4.7e-02
psoriasis -2.500 3.4e-05

 GO Component (1)

 Compartment GO Term (0)

Gene RIF (5)

AA Sequence

MVMAAKKGPGPGGGVSGGKAEAEAASEVWCRRVRELGGCSQAGNRHCFECAQRGVTYVDITVGSFVCTTC      1 - 70
SGLLRGLNPPHRVKSISMTTFTEPEVVFLQSRGNEVCRKIWLGLFDARTSLVPDSRDPQKVKEFLQEKYE     71 - 140
KKRWYVPPDQVKGPTYTKGSASTPVQGSIPEGKPLRTLLGDPAPSLSVAASTSSQPVSQSHARTSQARST    141 - 210
QPPPHSSVKKASTDLLADIGGDPFAAPQMAPAFAAFPAFGGQTPSQGGFANFDAFSSGPSSSVFGSLPPA    211 - 280
GQASFQAQPTPAGSSQGTPFGATPLAPASQPNSLADVGSFLGPGVPAAGVPSSLFGMAGQVPPLQSVTMG    281 - 350
GGGGSSTGLAFGAFTNPFTAPAAQSPLPSTNPFQPNGLAPGPGFGMSSAGPGFPQAVPPTGAFASSFPAP    351 - 420
LFPPQTPLVQQQNGSSFGDLGSAKLGQRPLSQPAGISTNPFMTGPSSSPFASKPPTTNPFL             421 - 481
//

Text Mined References (12)

PMID Year Title