Property Summary

NCBI Gene PubMed Count 10
PubMed Score 11.87
PubTator Score 25.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Gene RIF (8)

PMID Text
25496667 Genome-wide shRNA screening identifies HRBL, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
21358275 Genome-wide shRNA screening identifies HRBL, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
19149558 Genome-wide shRNA screening identifies HRBL, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
19149558 Genome-wide shRNA screening identifies HRBL, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
9303539 Genome-wide shRNA screening identifies HRBL, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
9303539 Genome-wide shRNA screening identifies HRBL, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
7568168 Genome-wide shRNA screening identifies HRBL, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
7568168 Genome-wide shRNA screening identifies HRBL, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells

AA Sequence

MVMAAKKGPGPGGGVSGGKAEAEAASEVWCRRVRELGGCSQAGNRHCFECAQRGVTYVDITVGSFVCTTC      1 - 70
SGLLRGLNPPHRVKSISMTTFTEPEVVFLQSRGNEVCRKIWLGLFDARTSLVPDSRDPQKVKEFLQEKYE     71 - 140
KKRWYVPPDQVKGPTYTKGSASTPVQGSIPEGKPLRTLLGDPAPSLSVAASTSSQPVSQSHARTSQARST    141 - 210
QPPPHSSVKKASTDLLADIGGDPFAAPQMAPAFAAFPAFGGQTPSQGGFANFDAFSSGPSSSVFGSLPPA    211 - 280
GQASFQAQPTPAGSSQGTPFGATPLAPASQPNSLADVGSFLGPGVPAAGVPSSLFGMAGQVPPLQSVTMG    281 - 350
GGGGSSTGLAFGAFTNPFTAPAAQSPLPSTNPFQPNGLAPGPGFGMSSAGPGFPQAVPPTGAFASSFPAP    351 - 420
LFPPQTPLVQQQNGSSFGDLGSAKLGQRPLSQPAGISTNPFMTGPSSSPFASKPPTTNPFL             421 - 481
//

Text Mined References (12)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10613896 1999 The eps15 homology (EH) domain-based interaction between eps15 and hrb connects the molecular machinery of endocytosis to that of nucleocytosolic transport.
9799793 1998 Large-scale sequencing of two regions in human chromosome 7q22: analysis of 650 kb of genomic sequence around the EPO and CUTL1 loci reveals 17 genes.
9303539 1997 Binding specificity and in vivo targets of the EH domain, a novel protein-protein interaction module.
More...