Property Summary

NCBI Gene PubMed Count 38
PubMed Score 9.22
PubTator Score 20.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adrenocortical carcinoma 1.724 2.6e-04
atypical teratoid / rhabdoid tumor 1.200 3.1e-03
Breast cancer 1.700 6.0e-11
colon cancer 2.200 1.5e-05
ductal carcinoma in situ 1.200 1.1e-02
group 3 medulloblastoma 1.500 1.7e-05
interstitial cystitis -1.200 2.1e-02
intraductal papillary-mucinous carcinoma... 1.200 3.0e-03
intraductal papillary-mucinous neoplasm ... 1.900 1.8e-03
invasive ductal carcinoma 1.900 7.7e-04
lung cancer 1.700 5.0e-03
malignant mesothelioma 2.200 9.2e-08
nasopharyngeal carcinoma 1.300 5.0e-05
non-small cell lung cancer 1.619 1.4e-15
ovarian cancer 1.300 3.8e-03

Gene RIF (20)

AA Sequence

MVGKARSSNFTLSEKLDLLKLVKPYVKILEEHTNKHSVIVEKNRCWDIIAVNYNAIGVDRPPRTAQGLRT      1 - 70
LYKRLKEYAKQELLQQKETQSDFKSNISEPTKKVMEMIPQISSFCLVRDRNHIQSANLDEEAQAGTSSLQ     71 - 140
VMLDHHPVAITVEVKQEEDIKPPPPLVLNSQQSDTLEQREEHELVHVMERSLSPSLSSVDMRMTSSPSSI    141 - 210
PRRDDFFRHESGEHFRSLLGYDPQILQMLKEEHQIILENQKNFGLYVQEKRDGLKRRQQLEEELLRAKIE    211 - 280
VEKLKAIRLRHDLPEYNSL                                                       281 - 299
//

Text Mined References (41)

PMID Year Title