Property Summary

NCBI Gene PubMed Count 12
Grant Count 31
R01 Count 31
Funding $3,769,760.3
PubMed Score 2.78
PubTator Score 29.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -1.800 0.000
astrocytic glioma 1.100 0.003
ependymoma 1.400 0.002
osteosarcoma -1.014 0.005
medulloblastoma 1.800 0.000
atypical teratoid / rhabdoid tumor 1.500 0.003
glioblastoma 1.200 0.005
medulloblastoma, large-cell 2.400 0.000
primitive neuroectodermal tumor 1.600 0.000
ovarian cancer -2.200 0.000

 GO Function (1)

Gene RIF (5)

PMID Text
20378615 Observational study of gene-disease association. (HuGE Navigator)
19463812 Data show that REC8 is constitutively expressed in tumour cells, along with SGOL1 and SGOL2, and that REC8 becomes modified after irradiation.
18570052 Indicate that polymorphisms of the Rec 8 gene are not a common cause of severe male factor infertility.
18570052 Observational study of gene-disease association. (HuGE Navigator)
15935783 The mouse ortholog of REC8L1 is required for proper synapsis of homologous chromosomes during meiosis

AA Sequence

MFYYPNVLQRHTGCFATIWLAATRGSRLVKREYLRVNVVKTCEEILNYVLVRVQPPQPGLPRPRFSLYLS      1 - 70
AQLQIGVIRVYSQQCQYLVEDIQHILERLHRAQLQIRIDMETELPSLLLPNHLAMMETLEDAPDPFFGMM     71 - 140
SVDPRLPSPFDIPQIRHLLEAAIPERVEEIPPEVPTEPREPERIPVTVLPPEAITILEAEPIRMLEIEGE    141 - 210
RELPEVSRRELDLLIAEEEEAILLEIPRLPPPAPAEVEGIGEALGPEELRLTGWEPGALLMEVTPPEELR    211 - 280
LPAPPSPERRPPVPPPPRRRRRRRLLFWDKETQISPEKFQEQLQTRAHCWECPMVQPPERTIRGPAELFR    281 - 350
TPTLSGWLPPELLGLWTHCAQPPPKALRRELPEEAAAEEERRKIEVPSEIEVPREALEPSVPLMVSLEIS    351 - 420
LEAAEEEKSRISLIPPEERWAWPEVEAPEAPALPVVPELPEVPMEMPLVLPPELELLSLEAVHRAVALEL    421 - 490
QANREPDFSSLVSPLSPRRMAARVFYLLLVLSAQQILHVKQEKPYGRLLIQPGPRFH                 491 - 547
//

Text Mined References (14)

PMID Year Title
20378615 2010 Evaluation of 172 candidate polymorphisms for association with oligozoospermia or azoospermia in a large cohort of men of European descent.
19463812 2009 The role of meiotic cohesin REC8 in chromosome segregation in gamma irradiation-induced endopolyploid tumour cells.
18570052 Analysis of the meiotic recombination gene REC8 for sequence variations in a population with severe male factor infertility.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15935783 2005 Absence of mouse REC8 cohesin promotes synapsis of sister chromatids in meiosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15125634 2004 Cohesin component dynamics during meiotic prophase I in mammalian oocytes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12759374 2003 Temporally and spatially selective loss of Rec8 protein from meiotic chromosomes during mammalian meiosis.
More...