Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.78
PubTator Score 29.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma 1.100 3.4e-03
atypical teratoid / rhabdoid tumor 1.500 3.4e-03
ependymoma 1.400 2.2e-03
glioblastoma 1.200 5.3e-03
group 3 medulloblastoma 1.300 8.6e-04
malignant mesothelioma -1.800 2.1e-07
medulloblastoma, large-cell 2.400 7.6e-05
osteosarcoma -1.014 4.7e-03
ovarian cancer -2.200 3.6e-08
primitive neuroectodermal tumor 1.600 2.5e-04

 GO Function (1)

Protein-protein Interaction (12)

Gene RIF (7)

AA Sequence

MFYYPNVLQRHTGCFATIWLAATRGSRLVKREYLRVNVVKTCEEILNYVLVRVQPPQPGLPRPRFSLYLS      1 - 70
AQLQIGVIRVYSQQCQYLVEDIQHILERLHRAQLQIRIDMETELPSLLLPNHLAMMETLEDAPDPFFGMM     71 - 140
SVDPRLPSPFDIPQIRHLLEAAIPERVEEIPPEVPTEPREPERIPVTVLPPEAITILEAEPIRMLEIEGE    141 - 210
RELPEVSRRELDLLIAEEEEAILLEIPRLPPPAPAEVEGIGEALGPEELRLTGWEPGALLMEVTPPEELR    211 - 280
LPAPPSPERRPPVPPPPRRRRRRRLLFWDKETQISPEKFQEQLQTRAHCWECPMVQPPERTIRGPAELFR    281 - 350
TPTLSGWLPPELLGLWTHCAQPPPKALRRELPEEAAAEEERRKIEVPSEIEVPREALEPSVPLMVSLEIS    351 - 420
LEAAEEEKSRISLIPPEERWAWPEVEAPEAPALPVVPELPEVPMEMPLVLPPELELLSLEAVHRAVALEL    421 - 490
QANREPDFSSLVSPLSPRRMAARVFYLLLVLSAQQILHVKQEKPYGRLLIQPGPRFH                 491 - 547
//

Text Mined References (16)

PMID Year Title