Property Summary

NCBI Gene PubMed Count 50
Grant Count 83
R01 Count 21
Funding $13,019,220.54
PubMed Score 565.73
PubTator Score 115.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma 1.100 0.023
hereditary spastic paraplegia -1.150 0.001
adrenocortical carcinoma 1.064 0.000
pancreatic ductal adenocarcinoma liver m... 1.148 0.008
Breast cancer 2.500 0.047
group 3 medulloblastoma 1.200 0.002
lung adenocarcinoma 1.203 0.000
ovarian cancer 1.100 0.018
dermatomyositis 1.300 0.001

Synonym

Accession O95071 B2RP24 J3KMW7 O94970 Q9NPL3
Symbols DD5
EDD
HYD
EDD1

Gene

PANTHER Protein Class (2)

PDB

1I2T   2QHO   3PT3  

Gene RIF (34)

PMID Text
26464214 Study highlights many functional biological role of UBR5 especially in cancer where it seems to be a key regulator of cell signaling. [review]
26438829 Elevated metaphase RanGTP levels use Ubr5 to couple overall chromosome congression to SAC silencing.
26340541 Human herpesvirus-6 U14 induces cell cycle arrest in G2/M phase by associating with a cellular protein, EDD.
26234678 Colony-formation assays and soft agar assays show that gain of function of TIP60 or depletion of EDD1 in HPV-positive cervical cancer cells significantly inhibits cell growth in vitro
26224628 results confirm the role of the MLLE domain of UBR5 in substrate recruitment and suggest a potential role in regulating UBR5 ligase activity.
25833949 these observations highlight the potential role of EDD in regulating mitotic progression and the cellular response to perturbed mitosis.
24441042 Utilizing a high throughput RNAi screening approach author identified UBR5, a protein commonly amplified in breast cancer, as a novel regulator of ERalpha protein levels and transcriptional activity.
24438055 UBR5 knockdown results in accumulation of cellular pregnane X receptor and an increase in its activity.
24379240 These results identify EDD as a dual regulator of cell survival and cisplatin resistance and suggest that EDD is a therapeutic target for ovarian cancer.
24145130 the alpha4 N-terminus binding to endogenous PP2Ac and PABP, and the C-terminus to EDD, is reported.
More...

AA Sequence

MTSIHFVVHPLPGTEDQLNDRLREVSEKLNKYNLNSHPPLNVLEQATIKQCVVGPNHAAFLLEDGRVCRI      1 - 70
GFSVQPDRLELGKPDNNDGSKLNSNSGAGRTSRPGRTSDSPWFLSGSETLGRLAGNTLGSRWSSGVGGSG     71 - 140
GGSSGRSSAGARDSRRQTRVIRTGRDRGSGLLGSQPQPVIPASVIPEELISQAQVVLQGKSRSVIIRELQ    141 - 210
RTNLDVNLAVNNLLSRDDEDGDDGDDTASESYLPGEDLMSLLDADIHSAHPSVIIDADAMFSEDISYFGY    211 - 280
PSFRRSSLSRLGSSRVLLLPLERDSELLRERESVLRLRERRWLDGASFDNERGSTSKEGEPNLDKKNTPV    281 - 350
QSPVSLGEDLQWWPDKDGTKFICIGALYSELLAVSSKGELYQWKWSESEPYRNAQNPSLHHPRATFLGLT    351 - 420
NEKIVLLSANSIRATVATENNKVATWVDETLSSVASKLEHTAQTYSELQGERIVSLHCCALYTCAQLENS    421 - 490
LYWWGVVPFSQRKKMLEKARAKNKKPKSSAGISSMPNITVGTQVCLRNNPLYHAGAVAFSISAGIPKVGV    491 - 560
LMESVWNMNDSCRFQLRSPESLKNMEKASKTTEAKPESKQEPVKTEMGPPPSPASTCSDASSIASSASMP    561 - 630
YKRRRSTPAPKEEEKVNEEQWSLREVVFVEDVKNVPVGKVLKVDGAYVAVKFPGTSSNTNCQNSSGPDAD    631 - 700
PSSLLQDCRLLRIDELQVVKTGGTPKVPDCFQRTPKKLCIPEKTEILAVNVDSKGVHAVLKTGNWVRYCI    701 - 770
FDLATGKAEQENNFPTSSIAFLGQNERNVAIFTAGQESPIILRDGNGTIYPMAKDCMGGIRDPDWLDLPP    771 - 840
ISSLGMGVHSLINLPANSTIKKKAAVIIMAVEKQTLMQHILRCDYEACRQYLMNLEQAVVLEQNLQMLQT    841 - 910
FISHRCDGNRNILHACVSVCFPTSNKETKEEEEAERSERNTFAERLSAVEAIANAISVVSSNGPGNRAGS    911 - 980
SSSRSLRLREMMRRSLRAAGLGRHEAGASSSDHQDPVSPPIAPPSWVPDPPAMDPDGDIDFILAPAVGSL    981 - 1050
TTAATGTGQGPSTSTIPGPSTEPSVVESKDRKANAHFILKLLCDSVVLQPYLRELLSAKDARGMTPFMSA   1051 - 1120
VSGRAYPAAITILETAQKIAKAEISSSEKEEDVFMGMVCPSGTNPDDSPLYVLCCNDTCSFTWTGAEHIN   1121 - 1190
QDIFECRTCGLLESLCCCTECARVCHKGHDCKLKRTSPTAYCDCWEKCKCKTLIAGQKSARLDLLYRLLT   1191 - 1260
ATNLVTLPNSRGEHLLLFLVQTVARQTVEHCQYRPPRIREDRNRKTASPEDSDMPDHDLEPPRFAQLALE   1261 - 1330
RVLQDWNALKSMIMFGSQENKDPLSASSRIGHLLPEEQVYLNQQSGTIRLDCFTHCLIVKCTADILLLDT   1331 - 1400
LLGTLVKELQNKYTPGRREEAIAVTMRFLRSVARVFVILSVEMASSKKKNNFIPQPIGKCKRVFQALLPY   1401 - 1470
AVEELCNVAESLIVPVRMGIARPTAPFTLASTSIDAMQGSEELFSVEPLPPRPSSDQSSSSSQSQSSYII   1471 - 1540
RNPQQRRISQSQPVRGRDEEQDDIVSADVEEVEVVEGVAGEEDHHDEQEEHGEENAEAEGQHDEHDEDGS   1541 - 1610
DMELDLLAAAETESDSESNHSNQDNASGRRSVVTAATAGSEAGASSVPAFFSEDDSQSNDSSDSDSSSSQ   1611 - 1680
SDDIEQETFMLDEPLERTTNSSHANGAAQAPRSMQWAVRNTQHQRAASTAPSSTSTPAASSAGLIYIDPS   1681 - 1750
NLRRSGTISTSAAAAAAALEASNASSYLTSASSLARAYSIVIRQISDLMGLIPKYNHLVYSQIPAAVKLT   1751 - 1820
YQDAVNLQNYVEEKLIPTWNWMVSIMDSTEAQLRYGSALASAGDPGHPNHPLHASQNSARRERMTAREEA   1821 - 1890
SLRTLEGRRRATLLSARQGMMSARGDFLNYALSLMRSHNDEHSDVLPVLDVCSLKHVAYVFQALIYWIKA   1891 - 1960
MNQQTTLDTPQLERKRTRELLELGIDNEDSEHENDDDTNQSATLNDKDDDSLPAETGQNHPFFRRSDSMT   1961 - 2030
FLGCIPPNPFEVPLAEAIPLADQPHLLQPNARKEDLFGRPSQGLYSSSASSGKCLMEVTVDRNCLEVLPT   2031 - 2100
KMSYAANLKNVMNMQNRQKKEGEEQPVLPEETESSKPGPSAHDLAAQLKSSLLAEIGLTESEGPPLTSFR   2101 - 2170
PQCSFMGMVISHDMLLGRWRLSLELFGRVFMEDVGAEPGSILTELGGFEVKESKFRREMEKLRNQQSRDL   2171 - 2240
SLEVDRDRDLLIQQTMRQLNNHFGRRCATTPMAVHRVKVTFKDEPGEGSGVARSFYTAIAQAFLSNEKLP   2241 - 2310
NLECIQNANKGTHTSLMQRLRNRGERDREREREREMRRSSGLRAGSRRDRDRDFRRQLSIDTRPFRPASE   2311 - 2380
GNPSDDPEPLPAHRQALGERLYPRVQAMQPAFASKITGMLLELSPAQLLLLLASEDSLRARVDEAMELII   2381 - 2450
AHGRENGADSILDLGLVDSSEKVQQENRKRHGSSRSVVDMDLDDTDDGDDNAPLFYQPGKRGFYTPRPGK   2451 - 2520
NTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSD   2521 - 2590
ADAVFSAMDLAFAIDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLD   2591 - 2660
VLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVEKMSMTERQDLV   2661 - 2730
YFWTSSPSLPASEEGFQPMPSITIRPPDDQHLPTANTCISRLYVPLYSSKQILKQKLLLAIKTKNFGFV    2731 - 2799
//

Text Mined References (66)

PMID Year Title
26464214 2015 Functional Roles of the E3 Ubiquitin Ligase UBR5 in Cancer.
26438829 2015 RanGTP aids anaphase entry through Ubr5-mediated protein turnover.
26340541 2015 Human Herpesvirus-6 U14 Induces Cell-Cycle Arrest in G2/M Phase by Associating with a Cellular Protein, EDD.
26234678 2016 E3 ligase EDD1/UBR5 is utilized by the HPV E6 oncogene to destabilize tumor suppressor TIP60.
26224628 2015 The MLLE domain of the ubiquitin ligase UBR5 binds to its catalytic domain to regulate substrate binding.
25833949 2015 EDD, a ubiquitin-protein ligase of the N-end rule pathway, associates with spindle assembly checkpoint components and regulates the mitotic response to nocodazole.
24656813 2014 Phosphorylation-dependent PIH1D1 interactions define substrate specificity of the R2TP cochaperone complex.
24441042 2015 Systems level-based RNAi screening by high content analysis identifies UBR5 as a regulator of estrogen receptor-? protein levels and activity.
24438055 2014 Stability of the human pregnane X receptor is regulated by E3 ligase UBR5 and serine/threonine kinase DYRK2.
24379240 2014 EDD enhances cell survival and cisplatin resistance and is a therapeutic target for epithelial ovarian cancer.
More...