Property Summary

NCBI Gene PubMed Count 16
PubMed Score 14.56
PubTator Score 2.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytoma 1.100 3.7e-24
Astrocytoma, Pilocytic 1.100 3.2e-07
glioblastoma 1.200 2.1e-02
lung adenocarcinoma 1.200 3.2e-05
medulloblastoma, large-cell 1.100 1.6e-04
oligodendroglioma 1.200 4.4e-02
osteosarcoma 1.153 1.4e-02
ovarian cancer 2.300 1.3e-05
pancreatic ductal adenocarcinoma liver m... -1.140 3.9e-02
posterior fossa group B ependymoma 1.200 1.7e-12
psoriasis 2.200 1.2e-05

Gene RIF (2)

AA Sequence

MAYHSGYGAHGSKHRARAAPDPPPLFDDTSGGYSSQPGGYPATGADVAFSVNHLLGDPMANVAMAYGSSI      1 - 70
ASHGKDMVHKELHRFVSVSKLKYFFAVDTAYVAKKLGLLVFPYTHQNWEVQYSRDAPLPPRQDLNAPDLY     71 - 140
IPTMAFITYVLLAGMALGIQKRFSPEVLGLCASTALVWVVMEVLALLLGLYLATVRSDLSTFHLLAYSGY    141 - 210
KYVGMILSVLTGLLFGSDGYYVALAWTSSALMYFIVRSLRTAALGPDSMGGPVPRQRLQLYLTLGAAAFQ    211 - 280
PLIIYWLTFHLVR                                                             281 - 293
//

Text Mined References (20)

PMID Year Title