Property Summary

NCBI Gene PubMed Count 16
Grant Count 5
Funding $2,583,350
PubMed Score 14.43
PubTator Score 2.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
oligodendroglioma 1.200 0.044
psoriasis 2.200 0.000
astrocytoma 1.200 0.012
glioblastoma 1.200 0.021
osteosarcoma 1.153 0.014
medulloblastoma, large-cell 1.100 0.000
pancreatic ductal adenocarcinoma liver m... -1.140 0.039
pilocytic astrocytoma 1.100 0.000
posterior fossa group B ependymoma 1.200 0.000
lung adenocarcinoma 1.200 0.000
ovarian cancer 2.300 0.000

Synonym

Accession O95070 A6NM00 Q96G83 Q9BVD0
Symbols 54TM
YIF1
YIF1P
FinGER7

Gene

Gene RIF (2)

PMID Text
18718466 YIF1A is involved in the maintenance of the Golgi structure.
15990086 Human Yip1A (YIPF5) interacts with and localizes human Yif1 (YIF1A) to the Golgi apparatus.

AA Sequence

MAYHSGYGAHGSKHRARAAPDPPPLFDDTSGGYSSQPGGYPATGADVAFSVNHLLGDPMANVAMAYGSSI      1 - 70
ASHGKDMVHKELHRFVSVSKLKYFFAVDTAYVAKKLGLLVFPYTHQNWEVQYSRDAPLPPRQDLNAPDLY     71 - 140
IPTMAFITYVLLAGMALGIQKRFSPEVLGLCASTALVWVVMEVLALLLGLYLATVRSDLSTFHLLAYSGY    141 - 210
KYVGMILSVLTGLLFGSDGYYVALAWTSSALMYFIVRSLRTAALGPDSMGGPVPRQRLQLYLTLGAAAFQ    211 - 280
PLIIYWLTFHLVR                                                             281 - 293
//

Text Mined References (20)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
23736259 2013 The ALS8 protein VAPB interacts with the ER-Golgi recycling protein YIF1A and regulates membrane delivery into dendrites.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22645275 2012 Identification of novel ATP13A2 interactors and their role in ?-synuclein misfolding and toxicity.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
18718466 2008 YIPF5 and YIF1A recycle between the ER and the Golgi apparatus and are involved in the maintenance of the Golgi structure.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
More...