Property Summary

NCBI Gene PubMed Count 66
Grant Count 71
R01 Count 39
Funding $12,158,561
PubMed Score 543.93
PubTator Score 279.06

Knowledge Summary

Patent (12,124)

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -1.300 0.000
osteosarcoma 2.022 0.008
adrenocortical carcinoma -2.282 0.000
interstitial cystitis -1.700 0.001
group 4 medulloblastoma 1.200 0.004
pilocytic astrocytoma 1.500 0.000

Synonym

Accession O95069 A1Z1V3 A8K618 B2RCS4 B7ZL56 D3DTA5 Q5DP47 Q5DP48 Q9NRT2 Q9UNE3
Symbols TREK
TPKC1
TREK1
K2p2.1
TREK-1
hTREK-1c
hTREK-1e

Gene

PDB

4TWK  

Gene RIF (55)

PMID Text
26400398 presence of TREK-1 variants correlated to reduced TREK-1 activity, suggesting a pathological role for TREK-1 variants in preterm labor
26332952 How ion channels sense mechanical force: insights from mechanosensitive K2P channels TRAAK, TREK1, and TREK2.
25962960 Data suggest that potassium channel protein TREK-1 (TREK-1) might be a biomarker in castration resistance free survival (CRFS) judgment of prostate cancer (PCa), as well as a potential therapeutic target.
25778785 We conclude that Trek1 is critical to maintain the nasal epithelial barrier function.
25683610 Trek1 expression facilitates the restoration of intestinal epithelial barrier functions in an allergic environment.
25529528 Nasal epithelia express Trek1 that can be suppressed by allergic response.
25482670 During conductance simulation experiments, both TASK-3 and TREK-1 channels were able to repolarise the membrane once AP threshold was reached
25197053 PLD2, but not PLD1, directly binds to the C terminus of TREK1 and TREK2.
25168769 Modulation of K2P 2.1 and K2P 10.1 K(+) channel sensitivity to carvedilol by alternative mRNA translation initiation
24801307 Response of the human detrusor to stretch is regulated by TREK-1
More...

AA Sequence

MLPSASRERPGYRAGVAAPDLLDPKSAAQNSKPRLSFSTKPTVLASRVESDTTINVMKWKTVSTIFLVVV      1 - 70
LYLIIGATVFKALEQPHEISQRTTIVIQKQTFISQHSCVNSTELDELIQQIVAAINAGIIPLGNTSNQIS     71 - 140
HWDLGSSFFFAGTVITTIGFGNISPRTEGGKIFCIIYALLGIPLFGFLLAGVGDQLGTIFGKGIAKVEDT    141 - 210
FIKWNVSQTKIRIISTIIFILFGCVLFVALPAIIFKHIEGWSALDAIYFVVITLTTIGFGDYVAGGSDIE    211 - 280
YLDFYKPVVWFWILVGLAYFAAVLSMIGDWLRVISKKTKEEVGEFRAHAAEWTANVTAEFKETRRRLSVE    281 - 350
IYDKFQRATSIKRKLSAELAGNHNQELTPCRRTLSVNHLTSERDVLPPLLKTESIYLNGLTPHCAGEEIA    351 - 420
VIENIK                                                                    421 - 426
//

Text Mined References (71)

PMID Year Title
26642364 2016 POPDC1(S201F) causes muscular dystrophy and arrhythmia by affecting protein trafficking.
26400398 2015 Alternatively Spliced Human TREK-1 Variants Alter TREK-1 Channel Function and Localization.
26332952 2015 How ion channels sense mechanical force: insights from mechanosensitive K2P channels TRAAK, TREK1, and TREK2.
25962960 2015 Prognostic significance of the TREK-1 K2P potassium channels in prostate cancer.
25778785 2015 Trek1 contributes to maintaining nasal epithelial barrier integrity.
25683610 2016 Regulation of TWIK-related potassium channel-1 (Trek1) restitutes intestinal epithelial barrier function.
25529528 2015 Regulation of Trek1 expression in nasal mucosa with allergic rhinitis by specific immunotherapy.
25482670 2015 Two-pore domain potassium channels enable action potential generation in the absence of voltage-gated potassium channels.
25197053 2014 Phospholipase D2 specifically regulates TREK potassium channels via direct interaction and local production of phosphatidic acid.
25168769 2014 Modulation of K2P 2.1 and K2P 10.1 K(+) channel sensitivity to carvedilol by alternative mRNA translation initiation.
More...