Property Summary

Ligand Count 20
NCBI Gene PubMed Count 73
PubMed Score 578.25
PubTator Score 279.06

Knowledge Summary

Patent (12,124)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Depressive disorder 409 0.0 0.0
Disease Target Count
Anhedonia 27
Mental Depression 333
Disease Target Count
General anesthesia 53
Disease Target Count P-value
Astrocytoma, Pilocytic 3081 2.8e-05
adrenocortical carcinoma 1428 4.7e-04
interstitial cystitis 2312 7.7e-04
group 4 medulloblastoma 1855 3.6e-03
osteosarcoma 7950 7.8e-03
psoriasis 6694 2.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Type 1 diabetes mellitus 109 0.0 1.4

Expression

  Differential Expression (6)

Disease log2 FC p
adrenocortical carcinoma -2.282 4.7e-04
Astrocytoma, Pilocytic 1.500 2.8e-05
group 4 medulloblastoma 1.200 3.6e-03
interstitial cystitis -1.700 7.7e-04
osteosarcoma 2.022 7.8e-03
psoriasis -1.200 2.1e-02

Gene RIF (62)

AA Sequence

MLPSASRERPGYRAGVAAPDLLDPKSAAQNSKPRLSFSTKPTVLASRVESDTTINVMKWKTVSTIFLVVV      1 - 70
LYLIIGATVFKALEQPHEISQRTTIVIQKQTFISQHSCVNSTELDELIQQIVAAINAGIIPLGNTSNQIS     71 - 140
HWDLGSSFFFAGTVITTIGFGNISPRTEGGKIFCIIYALLGIPLFGFLLAGVGDQLGTIFGKGIAKVEDT    141 - 210
FIKWNVSQTKIRIISTIIFILFGCVLFVALPAIIFKHIEGWSALDAIYFVVITLTTIGFGDYVAGGSDIE    211 - 280
YLDFYKPVVWFWILVGLAYFAAVLSMIGDWLRVISKKTKEEVGEFRAHAAEWTANVTAEFKETRRRLSVE    281 - 350
IYDKFQRATSIKRKLSAELAGNHNQELTPCRRTLSVNHLTSERDVLPPLLKTESIYLNGLTPHCAGEEIA    351 - 420
VIENIK                                                                    421 - 426
//

Text Mined References (78)

PMID Year Title