Property Summary

NCBI Gene PubMed Count 48
Grant Count 7
R01 Count 7
Funding $289,046.24
PubMed Score 82.64
PubTator Score 41.45

Knowledge Summary

Patent

No data available

Expression

Gene RIF (27)

PMID Text
26349989 overexpression of CCNB2 protein is associated with clinical progression and poor prognosis in non-small cell lung cancer
24375198 there was no significance in the 5-year overall survival rates among the patients with squamous cell carcinoma between expressing lower and higher level of cyclin B2 mRNA
24324638 Cyclin B1 and cyclin B2 are interchangeable for ability to promote G2 and M transition in HeLa cells.
23282137 Suggest that cytoplasmic CCNB2 may function as an oncogene and could serve as a potential biomarker of unfavorable prognosis over short-term follow-up in breast cancer.
21161946 The relative expression level of circulating CCNB2 mRNA in cancer patients was significantly higher than that in normal controls and benign diseases group. Circulating CCNB2 mRNA level significantly correlated with cancer stage and metastasis status.
20660152 Data suggest that cyclin A2 helps initiate mitosis, in part through its effects on cyclin B1, and that cyclins B1 and B2 are particularly critical for the maintenance of the mitotic state.
19738611 Observational study of gene-disease association. (HuGE Navigator)
19664331 The radiosensitizing effect of paclitaxel on KB cells may be due to the down-regulated expression of PRC1 and cyclin B2.
19223528 an increased CCNB2 expression in human pituitary adenomas of different histotypes that is directly correlated with HMGA1 and HMGA2 expression.
18692784 The CCNA1, CCNB1, CCNB2, PRM1, and PRM2 messenger RNA transcript ratios were significantly decreased in patients with spermatogenic disorders. Transcript ratios in patients with successful sperm retrieval were higher than with failed sperm retrieval.
More...

AA Sequence

MALLRRPTVSSDLENIDTGVNSKVKSHVTIRRTVLEEIGNRVTTRAAQVAKKAQNTKVPVQPTKTTNVNK      1 - 70
QLKPTASVKPVQMEKLAPKGPSPTPEDVSMKEENLCQAFSDALLCKIEDIDNEDWENPQLCSDYVKDIYQ     71 - 140
YLRQLEVLQSINPHFLDGRDINGRMRAILVDWLVQVHSKFRLLQETLYMCVGIMDRFLQVQPVSRKKLQL    141 - 210
VGITALLLASKYEEMFSPNIEDFVYITDNAYTSSQIREMETLILKELKFELGRPLPLHFLRRASKAGEVD    211 - 280
VEQHTLAKYLMELTLIDYDMVHYHPSKVAAAASCLSQKVLGQGKWNLKQQYYTGYTENEVLEVMQHMAKN    281 - 350
VVKVNENLTKFIAIKNKYASSKLLKISMIPQLNSKAVKDLASPLIGRS                          351 - 398
//

Text Mined References (55)

PMID Year Title
26349989 2015 CCNB2 overexpression is a poor prognostic biomarker in Chinese NSCLC patients.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24375198 2014 Strong expression of cyclin B2 mRNA correlates with a poor prognosis in patients with non-small cell lung cancer.
24324638 2013 The kinetics of G2 and M transitions regulated by B cyclins.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23282137 2013 Elevated cyclin B2 expression in invasive breast carcinoma is associated with unfavorable clinical outcome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22916037 2012 Novel Loci for metabolic networks and multi-tissue expression studies reveal genes for atherosclerosis.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21269460 2011 Initial characterization of the human central proteome.
More...