Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.00
PubTator Score 380.99

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O95059 Q53X97
Symbols P14
HsHTD2

Gene

Gene RIF (1)

PMID Text
11929972 A protein subunit of human RNase P, Rpp14, and its interacting partner, OIP2, have 3'-->5' exoribonuclease activity.

AA Sequence

MPAPAATYERVVYKNPSEYHYMKVCLEFQDCGVGLNAAQFKQLLISAVKDLFGEVDAALPLDILTYEEKT      1 - 70
LSAILRICSSGLVKLWSSLTLLGSYKGKKCAFRVIQVSPFLLALSGNSRELVLD                     71 - 124
//

Text Mined References (17)

PMID Year Title
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
17898086 2008 An ancient genetic link between vertebrate mitochondrial fatty acid synthesis and RNA processing.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15096576 2004 Mutual interactions between subunits of the human RNase MRP ribonucleoprotein complex.
More...