Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.00
PubTator Score 11.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.200 6.7e-03
astrocytic glioma -1.400 1.8e-03
Astrocytoma, Pilocytic -1.300 1.9e-05
atypical teratoid / rhabdoid tumor -1.200 3.2e-05
ependymoma -1.100 1.5e-06
fibroadenoma 1.100 4.8e-02
glioblastoma -1.200 1.7e-05
medulloblastoma, large-cell -1.400 3.0e-04
psoriasis -1.300 1.0e-40
sonic hedgehog group medulloblastoma -1.100 4.4e-03
spina bifida 1.131 3.7e-02

Gene RIF (4)

AA Sequence

MPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPA      1 - 70
MQRLSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKGSVEDIPVMLVGNKCDETQREVDTREAQAVAQ     71 - 140
EWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVKGKCTLM                141 - 198
//

Text Mined References (10)

PMID Year Title