Property Summary

NCBI Gene PubMed Count 9
Grant Count 184
R01 Count 30
Funding $34,213,400.25
PubMed Score 0.00
PubTator Score 11.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.400 0.002
posterior fossa group B ependymoma -1.600 0.000
glioblastoma -1.200 0.000
atypical teratoid/rhabdoid tumor -1.400 0.000
medulloblastoma, large-cell -1.400 0.000
fibroadenoma 1.100 0.048
adult high grade glioma -1.200 0.007
pilocytic astrocytoma -1.300 0.000
sonic hedgehog group medulloblastoma -1.100 0.004
spina bifida 1.131 0.037
psoriasis -1.300 0.000

Synonym

Accession O95057
Symbols RIG
GBTS1
Di-Ras1

Gene

PDB

2GF0  

Gene RIF (3)

PMID Text
26814130 DiRas1 expression inhibits malignant features of cancers in part by nonproductively binding to SmgGDS and inhibiting the binding of other small GTPases to SmgGDS
23436800 DIRAS1 downregulation is associated with esophageal squamous cell carcinoma metastasis.
12107278 a novel Ras-related protein and potential neural tumor suppressor (RIG)

AA Sequence

MPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPA      1 - 70
MQRLSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKGSVEDIPVMLVGNKCDETQREVDTREAQAVAQ     71 - 140
EWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVKGKCTLM                141 - 198
//

Text Mined References (9)

PMID Year Title
26814130 2016 The Tumor-suppressive Small GTPase DiRas1 Binds the Noncanonical Guanine Nucleotide Exchange Factor SmgGDS and Antagonizes SmgGDS Interactions with Oncogenic Small GTPases.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
23436800 2013 Downregulation of the novel tumor suppressor DIRAS1 predicts poor prognosis in esophageal squamous cell carcinoma.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12194967 2002 Di-Ras, a distinct subgroup of ras family GTPases with unique biochemical properties.
12107278 2002 Rig is a novel Ras-related protein and potential neural tumor suppressor.