Property Summary

Ligand Count 2
NCBI Gene PubMed Count 15
PubMed Score 58.74
PubTator Score 27.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Gene RIF (4)

AA Sequence

MKGGFTGGDEYQKHFLPRDYLATYYSFDGSPSPEAEMLKFNLECLHKTFGPGGLQGDTLIDIGSGPTIYQ      1 - 70
VLAACDSFQDITLSDFTDRNREELEKWLKKEPGAYDWTPAVKFACELEGNSGRWEEKEEKLRAAVKRVLK     71 - 140
CDVHLGNPLAPAVLPLADCVLTLLAMECACCSLDAYRAALCNLASLLKPGGHLVTTVTLRLPSYMVGKRE    141 - 210
FSCVALEKEEVEQAVLDAGFDIEQLLHSPQSYSVTNAANNGVCFIVARKKPGP                     211 - 263
//

Text Mined References (17)

PMID Year Title