Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.85
PubTator Score 0.83

Knowledge Summary

Patent (388)

AA Sequence

MGDNITSIREFLLLGFPVGPRIQMLLFGLFSLFYVFTLLGNGTILGLISLDSRLHAPMYFFLSHLAVVDI      1 - 70
AYACNTVPRMLVNLLHPAKPISFAGRMMQTFLFSTFAVTECLLLVVMSYDLYVAICHPLRYLAIMTWRVC     71 - 140
ITLAVTSWTTGVLLSLIHLVLLLPLPFCRPQKIYHFFCEILAVLKLACADTHINENMVLAGAISGLVGPL    141 - 210
STIVVSYMCILCAILQIQSREVQRKAFRTCFSHLCVIGLVYGTAIIMYVGPRYGNPKEQKKYLLLFHSLF    211 - 280
NPMLNPLICSLRNSEVKNTLKRVLGVERAL                                            281 - 310
//

Text Mined References (6)

PMID Year Title