Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.85
PubTator Score 0.83

Knowledge Summary

Patent (388)

Synonym

Accession O95047 Q0VAR3 Q6IF18 Q9NQN0
Symbols OR2A10

Gene

AA Sequence

MGDNITSIREFLLLGFPVGPRIQMLLFGLFSLFYVFTLLGNGTILGLISLDSRLHAPMYFFLSHLAVVDI      1 - 70
AYACNTVPRMLVNLLHPAKPISFAGRMMQTFLFSTFAVTECLLLVVMSYDLYVAICHPLRYLAIMTWRVC     71 - 140
ITLAVTSWTTGVLLSLIHLVLLLPLPFCRPQKIYHFFCEILAVLKLACADTHINENMVLAGAISGLVGPL    141 - 210
STIVVSYMCILCAILQIQSREVQRKAFRTCFSHLCVIGLVYGTAIIMYVGPRYGNPKEQKKYLLLFHSLF    211 - 280
NPMLNPLICSLRNSEVKNTLKRVLGVERAL                                            281 - 310
//

Text Mined References (6)

PMID Year Title
22888021 2012 G protein-coupled receptors participate in cytokinesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.