Property Summary

NCBI Gene PubMed Count 14
PubMed Score 4.44
PubTator Score 5.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 6.99177834758618E-11
glioblastoma 5572 2.31780197649086E-8
medulloblastoma 1524 1.79679364417267E-7
pediatric high grade glioma 2712 4.27361270927599E-7
ependymoma 2514 1.60846667183359E-6
primitive neuroectodermal tumor 3031 1.63919065311573E-6
medulloblastoma, large-cell 6234 1.2838313672631E-5
pancreatic ductal adenocarcinoma liver metastasis 1795 6.1044891391284E-4
oligodendroglioma 2849 0.0103308457723862
Disease Target Count Z-score Confidence
Alzheimer's disease 644 0.0 2.0
Disease Target Count Z-score Confidence
Timothy syndrome 12 4.041 2.0

Expression

  Differential Expression (9)

Synonym

Accession O95045 B3KV87 UPase 2
Symbols UP2
UPASE2
UDRPASE2

Gene

PANTHER Protein Class (2)

PDB

2XRF   3P0E   3P0F  

  Ortholog (6)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (4)

PMID Text
21855639 A novel structural mechanism for redox regulation of uridine phosphorylase 2 activity
21151189 This study demonistrated that use joint test to identified that UPP2 association to Autism Spectrum Disorder.
19401682 Observational study of gene-disease association. (HuGE Navigator)
12849978 identification of the novel human uridine phosphorylase, UDPase 2, with broad substrate specificity; UPase-2 gene was mapped to chromosome 2q24.1 and the 2.2-kb mRNA was predominantly expressed in kidney

AA Sequence

MASVIPASNRSMRSDRNTYVGKRFVHVKNPYLDLMDEDILYHLDLGTKTHNLPAMFGDVKFVCVGGSPNR      1 - 70
MKAFALFMHKELGFEEAEEDIKDICAGTDRYCMYKTGPVLAISHGMGIPSISIMLHELIKLLHHARCCDV     71 - 140
TIIRIGTSGGIGIAPGTVVITDIAVDSFFKPRFEQVILDNIVTRSTELDKELSEELFNCSKEIPNFPTLV    141 - 210
GHTMCTYDFYEGQGRLDGALCSFSREKKLDYLKRAFKAGVRNIEMESTVFAAMCGLCGLKAAVVCVTLLD    211 - 280
RLDCDQINLPHDVLVEYQQRPQLLISNFIRRRLGLCD                                     281 - 317
//

Text Mined References (14)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25416956 2014 A proteome-scale map of the human interactome network.
21855639 2011 A novel structural mechanism for redox regulation of uridine phosphorylase 2 activity.
21151189 2012 Allowing for sex differences increases power in a GWAS of multiplex Autism families.
20932310 2010 Genome-wide association reveals genetic effects on human A?42 and ? protein levels in cerebrospinal fluids: a case control study.
19401682 2010 High-density SNP association study and copy number variation analysis of the AUTS1 and AUTS5 loci implicate the IMMP2L-DOCK4 gene region in autism susceptibility.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...