Property Summary

NCBI Gene PubMed Count 14
PubMed Score 4.44
PubTator Score 5.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Synonym

Accession O95045 B3KV87 UPase 2
Symbols UP2
UPASE2
UDRPASE2

Gene

PANTHER Protein Class (2)

PDB

2XRF   3P0E   3P0F  

Gene RIF (4)

PMID Text
21855639 A novel structural mechanism for redox regulation of uridine phosphorylase 2 activity
21151189 This study demonistrated that use joint test to identified that UPP2 association to Autism Spectrum Disorder.
19401682 Observational study of gene-disease association. (HuGE Navigator)
12849978 identification of the novel human uridine phosphorylase, UDPase 2, with broad substrate specificity; UPase-2 gene was mapped to chromosome 2q24.1 and the 2.2-kb mRNA was predominantly expressed in kidney

AA Sequence

MASVIPASNRSMRSDRNTYVGKRFVHVKNPYLDLMDEDILYHLDLGTKTHNLPAMFGDVKFVCVGGSPNR      1 - 70
MKAFALFMHKELGFEEAEEDIKDICAGTDRYCMYKTGPVLAISHGMGIPSISIMLHELIKLLHHARCCDV     71 - 140
TIIRIGTSGGIGIAPGTVVITDIAVDSFFKPRFEQVILDNIVTRSTELDKELSEELFNCSKEIPNFPTLV    141 - 210
GHTMCTYDFYEGQGRLDGALCSFSREKKLDYLKRAFKAGVRNIEMESTVFAAMCGLCGLKAAVVCVTLLD    211 - 280
RLDCDQINLPHDVLVEYQQRPQLLISNFIRRRLGLCD                                     281 - 317
//

Text Mined References (14)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25416956 2014 A proteome-scale map of the human interactome network.
21855639 2011 A novel structural mechanism for redox regulation of uridine phosphorylase 2 activity.
21151189 2012 Allowing for sex differences increases power in a GWAS of multiplex Autism families.
20932310 2010 Genome-wide association reveals genetic effects on human A?42 and ? protein levels in cerebrospinal fluids: a case control study.
19401682 2010 High-density SNP association study and copy number variation analysis of the AUTS1 and AUTS5 loci implicate the IMMP2L-DOCK4 gene region in autism susceptibility.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...