Property Summary

NCBI Gene PubMed Count 16
Grant Count 28
R01 Count 18
Funding $3,653,583.72
PubMed Score 45.09
PubTator Score 15.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma 1.100 0.038
lung cancer 2.400 0.002
lung adenocarcinoma -1.500 0.000
ovarian cancer -1.700 0.000
psoriasis -1.100 0.000

Gene RIF (10)

PMID Text
26286962 Data show significant increases in semaphorin3C, 3D and their receptor neuropilin-2 in degenerate samples which were shown to contain nerves and blood vessels, compared to non-degenerate samples without nerves and blood vessels.
26073756 CTNNA3 and SEMA3D: Promising loci for asthma exacerbation identified through multiple genome-wide association studies
25839327 Functional loss of semaphorin 3C and/or semaphorin 3D and their epistatic interaction with ret are critical to Hirschsprung disease liability.
24825896 Semaphorin 3d requires neuropilin 1 or PI3K/Akt, whereas semaphorin 3e requires plexin D1 in directing endothelial motility.
23685842 In the absence of Sema3d, endothelial tubes form in a region that is normally avascular
23372769 in this study we have analyzed three aminoacidic substitutions, A131T-SEMA3A, S598G-SEMA3A and E198K-SEMA3D. These variants result in an increase of SEMA proteins levels in the HSCR colon tissue.
20684831 This study provided strong evidence that SEMA3D confers susceptibility to schizophrenia, which could contribute to the neurodevelopmental impairments in the disorder.
20684831 Observational study of gene-disease association. (HuGE Navigator)
19054571 Observational study of gene-disease association. (HuGE Navigator)
18818766 Sema3D inhibits tumor development from MDA-MB-231 and MDA-MB-435 cancer cells. It inhibits tumor angiogenesis in all of the formed tumors.

AA Sequence

MNANKDERLKARSQDFHLFPALMMLSMTMLFLPVTGTLKQNIPRLKLTYKDLLLSNSCIPFLGSSEGLDF      1 - 70
QTLLLDEERGRLLLGAKDHIFLLSLVDLNKNFKKIYWPAAKERVELCKLAGKDANTECANFIRVLQPYNK     71 - 140
THIYVCGTGAFHPICGYIDLGVYKEDIIFKLDTHNLESGRLKCPFDPQQPFASVMTDEYLYSGTASDFLG    141 - 210
KDTAFTRSLGPTHDHHYIRTDISEHYWLNGAKFIGTFFIPDTYNPDDDKIYFFFRESSQEGSTSDKTILS    211 - 280
RVGRVCKNDVGGQRSLINKWTTFLKARLICSIPGSDGADTYFDELQDIYLLPTRDERNPVVYGVFTTTSS    281 - 350
IFKGSAVCVYSMADIRAVFNGPYAHKESADHRWVQYDGRIPYPRPGTCPSKTYDPLIKSTRDFPDDVISF    351 - 420
IKRHSVMYKSVYPVAGGPTFKRINVDYRLTQIVVDHVIAEDGQYDVMFLGTDIGTVLKVVSISKEKWNME    421 - 490
EVVLEELQIFKHSSIILNMELSLKQQQLYIGSRDGLVQLSLHRCDTYGKACADCCLARDPYCAWDGNACS    491 - 560
RYAPTSKRRARRQDVKYGDPITQCWDIEDSISHETADEKVIFGIEFNSTFLECIPKSQQATIKWYIQRSG    561 - 630
DEHREELKPDERIIKTEYGLLIRSLQKKDSGMYYCKAQEHTFIHTIVKLTLNVIENEQMENTQRAEHEEG    631 - 700
KVKDLLAESRLRYKDYIQILSSPNFSLDQYCEQMWHREKRRQRNKGGPKWKHMQEMKKKRNRRHHRDLDE    701 - 770
LPRAVAT                                                                   771 - 777
//

Text Mined References (16)

PMID Year Title
26286962 2015 Class 3 semaphorins expression and association with innervation and angiogenesis within the degenerate human intervertebral disc.
26073756 2015 CTNNA3 and SEMA3D: Promising loci for asthma exacerbation identified through multiple genome-wide association studies.
25839327 2015 Functional loss of semaphorin 3C and/or semaphorin 3D and their epistatic interaction with ret are critical to Hirschsprung disease liability.
24825896 2014 Semaphorin 3d and semaphorin 3e direct endothelial motility through distinct molecular signaling pathways.
23685842 2013 Semaphorin 3d signaling defects are associated with anomalous pulmonary venous connections.
23372769 2013 Mutational spectrum of semaphorin 3A and semaphorin 3D genes in Spanish Hirschsprung patients.
20684831 2011 Possible association of the semaphorin 3D gene (SEMA3D) with schizophrenia.
19054571 2009 Polymorphisms in genes involved in neurodevelopment may be associated with altered brain morphology in schizophrenia: preliminary evidence.
18818766 2008 Successful inhibition of tumor development by specific class-3 semaphorins is associated with expression of appropriate semaphorin receptors by tumor cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...