Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent (156)

AA Sequence

MDGENHSVVSEFLFLGLTHSWEIQLLLLVFSSVLYVASITGNIFIVFSVTTDPHLHSPMYFLLASLSFID      1 - 70
LGACSVTSPKMIYDLFRKRKVISFGGCIAQIFFIHVIGGVEMVLLIAMAFDRYVALCKPLHYLTIMSPRM     71 - 140
CLSFLAVAWTLGVSHSLFQLAFLVNLAFCGPNVLDSFYCDLPRLLRLACTDTYRLQFMVTVNSGFICVGT    141 - 210
FFILLISYVFILFTVWKHSSGGSSKALSTLSAHSTVVLLFFGPPMFVYTRPHPNSQMDKFLAIFDAVLTP    211 - 280
FLNPVVYTFRNKEMKAAIKRVCKQLVIYKKIS                                          281 - 312
//

Text Mined References (1)

PMID Year Title
16421571 2006 DNA sequence and analysis of human chromosome 8.