Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 23.70

Knowledge Summary

Patent (251)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

AA Sequence

MELENQTRVTKFILVGFPGSLSMRAAMFLIFLVAYILTVAENVIIILLVLQNRPLHKPMYFFLANLSFLE      1 - 70
TWYISVTVPKLLFSFWSVNNSISFTLCMIQLYFFIALMCTECVLLAAMAYDRYVAICRPLHYPTIMSHGL     71 - 140
CFRLALGSWAIGFGISLAKIYFISCLSFCGPNVINHFFCDISPVLNLSCTDMSITELVDFILALVIFLFP    141 - 210
LFITVLSYGCILATILCMPTGKQKAFSTCASHLVVVTIFYSAIIFMYARPRVIHAFNMNKIISIFYAIVT    211 - 280
PSLNPFIYCLRNREVKEALKKLAYCQASRSD                                           281 - 311
//

Text Mined References (6)

PMID Year Title