Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 33.37

Knowledge Summary

Patent (231)


Accession O95006 A4D2G0 Q6IFP8
Symbols OR7-1


  Ortholog (4)

Species Source
Chimp OMA EggNOG
Rat OMA Inparanoid
Dog OMA Inparanoid
Pig OMA Inparanoid

Gene RIF (1)

20855565 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

VMPLLNPVIYSLRNKEVKGAWHKLLEKFSGLTSKLGT                                     281 - 317

Text Mined References (6)

PMID Year Title
20855565 2010 Common genetic variation in multiple metabolic pathways influences susceptibility to low HDL-cholesterol and coronary heart disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.