Property Summary

NCBI Gene PubMed Count 18
PubMed Score 5.92
PubTator Score 6.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Ocular hypertension 27 3.013 1.5

Expression

Gene RIF (2)

PMID Text
26330328 SOX30 expression represents an important prognostic factor for survival time in lung adenocarcinoma patients.
25435374 Blockade of p53 attenuates the tumor inhibition of SOX30.

AA Sequence

MERARPEPPPQPRPLRPAPPPLPVEGTSFWAAAMEPPPSSPTLSAAASATLASSCGEAVASGLQPAVRRL      1 - 70
LQVKPEQVLLLPQPQAQNEEAAASSAQARLLQFRPDLRLLQPPTASDGATSRPELHPVQPLALHVKAKKQ     71 - 140
KLGPSLDQSVGPRGAVETGPRASRVVKLEGPGPALGYFRGDEKGKLEAEEVMRDSMQGGAGKSPAAIREG    141 - 210
VIKTEEPERLLEDCRLGAEPASNGLVHGSAEVILAPTSGAFGPHQQDLRIPLTLHTVPPGARIQFQGAPP    211 - 280
SELIRLTKVPLTPVPTKMQSLLEPSVKIETKDVPLTVLPSDAGIPDTPFSKDRNGHVKRPMNAFMVWARI    281 - 350
HRPALAKANPAANNAEISVQLGLEWNKLSEEQKKPYYDEAQKIKEKHREEFPGWVYQPRPGKRKRFPLSV    351 - 420
SNVFSGTTQNIISTNPTTVYPYRSPTYSVVIPSLQNPITHPVGETSPAIQLPTPAVQSPSPVTLFQPSVS    421 - 490
SAAQVAVQDPSLPVYPALPPQRFTGPSQTDTHQLHSEATHTVKQPTPVSLESANRISSSASTAHARFATS    491 - 560
TIQPPREYSSVSPCPRSAPIPQASPIPHPHVYQPPPLGHPATLFGTPPRFSFHHPYFLPGPHYFPSSTCP    561 - 630
YSRPPFGYGNFPSSMPECLSYYEDRYPKHEGIFSTLNRDYSFRDYSSECTHSENSRSCENMNGTSYYNSH    631 - 700
SHSGEENLNPVPQLDIGTLENVFTAPTSTPSSIQQVNVTDSDEEEEEKVLRDL                     701 - 753
//

Text Mined References (18)

PMID Year Title
26330328 2015 High expression of SOX30 is associated with favorable survival in human lung adenocarcinoma.
25609838 2015 Combining RNA and protein profiling data with network interactions identifies genes associated with spermatogenesis in mouse and human.
25435374 2015 SOX30, a novel epigenetic silenced tumor suppressor, promotes tumor cell apoptosis by transcriptional activating p53 in lung cancer.
25416956 2014 A proteome-scale map of the human interactome network.
23872309 2013 Comprehensive whole-genome sequencing of an early-stage primary myelofibrosis patient defines low mutational burden and non-recurrent candidate genes.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21143990 2010 Characterization, phylogeny, alternative splicing and expression of Sox30 gene.
18436822 2008 Gene expression profiles of human trabecular meshwork cells induced by triamcinolone and dexamethasone.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16571642 2006 The human cumulus--oocyte complex gene-expression profile.
More...