Property Summary

NCBI Gene PubMed Count 54
Grant Count 66
R01 Count 36
Funding $4,577,801.41
PubMed Score 61.16
PubTator Score 59.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -2.806 0.000
sonic hedgehog group medulloblastoma -1.800 0.000
medulloblastoma, large-cell -1.900 0.000
adrenocortical carcinoma -1.365 0.000
adult high grade glioma -1.100 0.001
acute myeloid leukemia 1.300 0.050
ovarian cancer 1.300 0.023

Synonym

Accession O94992 B2R8Y5
Symbols CLP1
EDG1
HIS1
MAQ1

Gene

PDB

2GD7   3S9G  

Gene RIF (109)

PMID Text
27058786 Results show that HEXIM1 is a tumor suppressor in melanoma that responds to nucleotide stress by inhibiting transcription elongation of tumorigenic genes and stabilizing mRNA transcripts of other tumor suppressor genes.
26608417 Suggest that greater tumor associated macrophage density, strong Hexim1 expression, strong SMAD2 expression, and mild SMAD7 expression play important roles in the progression of prostate adenocarcinoma.
26324325 PPM1G phosphatase directly binds 7SK RNA and the kinase inhibitor Hexim1 once P-TEFb has been released from the 7SK snRNP.
25863285 Data indicate the binding of RNA-binding protein HEXIM with 7SKsnRNP complex comprising the non-coding RNA 7SK and proteins MePCE and LARP7.
24844355 HEXIM1 functions as an AR (androgen receptor) co-repressor as it physically interacts with the AR and is required for the ability of anti-androgens to inhibit androgen-induced target gene expression and cell proliferation.
24515107 the release of P-TEFb from the 7SK snRNP led to increased synthesis of HEXIM1 but not HEXIM2
24367103 CDK9-CycT1-AFF1 is stimulated by HIV-1 Tat and transferred as a single complex unit to BRD4 upon stress-induced disruption of AFF1-containing 7SK snRNP (HEXIM1, MEPCE, LARP7, 7SK RNA, CDK9, CycT1, and AFF1)
24367103 CDK9-CycT1-AFF1 is stimulated by HIV-1 Tat and transferred as a single complex unit to BRD4 upon stress-induced disruption of AFF1-containing 7SK snRNP (HEXIM1, MEPCE, LARP7, 7SK RNA, CDK9, CycT1, and AFF1)
24015760 There is evidence for a direct interaction between HIF-1alpha and HEXIM1, and HEXIM1 up-regulated hydroxylation of HIF-1alpha.
23977357 This study demonstrates a novel role of HEXIM1 in regulating human pluripotent stem cells fate through a P-TEFb-independent pathway.
More...

AA Sequence

MAEPFLSEYQHQPQTSNCTGAAAVQEELNPERPPGAEERVPEEDSRWQSRAFPQLGGRPGPEGEGSLESQ      1 - 70
PPPLQTQACPESSCLREGEKGQNGDDSSAGGDFPPPAEVEPTPEAELLAQPCHDSEASKLGAPAAGGEEE     71 - 140
WGQQQRQLGKKKHRRRPSKKKRHWKPYYKLTWEEKKKFDEKQSLRASRIRAEMFAKGQPVAPYNTTQFLM    141 - 210
DDHDQEEPDLKTGLYSKRAAAKSDDTSDDDFMEEGGEEDGGSDGMGGDGSEFLQRDFSETYERYHTESLQ    211 - 280
NMSKQELIKEYLELEKCLSRMEDENNRLRLESKRLGGDDARVRELELELDRLRAENLQLLTENELHRQQE    281 - 350
RAPLSKFGD                                                                 351 - 359
//

Text Mined References (67)

PMID Year Title
27058786 2016 Stress from Nucleotide Depletion Activates the Transcriptional Regulator HEXIM1 to Suppress Melanoma.
26608417 2016 Role of tumor-associated macrophages in the Hexim1 and TGF?/SMAD pathway, and their influence on progression of prostatic adenocarcinoma.
26324325 2015 PPM1G Binds 7SK RNA and Hexim1 To Block P-TEFb Assembly into the 7SK snRNP and Sustain Transcription Elongation.
25863285 2015 Intermolecular recognition of the non-coding RNA 7SK and HEXIM protein in perspective.
24844355 2014 HEXIM1 plays a critical role in the inhibition of the androgen receptor by anti-androgens.
24515107 2014 Release of positive transcription elongation factor b (P-TEFb) from 7SK small nuclear ribonucleoprotein (snRNP) activates hexamethylene bisacetamide-inducible protein (HEXIM1) transcription.
24360279 2013 Brd4 and JMJD6-associated anti-pause enhancers in regulation of transcriptional pause release.
24015760 2013 HEXIM1 down-regulates hypoxia-inducible factor-1? protein stability.
23977357 2013 HEXIM1 induces differentiation of human pluripotent stem cells.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
More...