Property Summary

NCBI Gene PubMed Count 10
PubMed Score 6.92
PubTator Score 1.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count
obsessive-compulsive disorder 34
Disease Target Count P-value
psoriasis 6685 1.02947516881006E-31
ovarian cancer 8492 4.91006993160111E-9
group 4 medulloblastoma 1875 1.15886659879217E-7
cystic fibrosis 1670 1.55651827591285E-6
adult high grade glioma 2148 4.42228199867561E-6
medulloblastoma, large-cell 6234 4.51780885286628E-6
ependymoma 2514 7.00653395222145E-6
glioblastoma 5572 1.00958222897759E-5
pituitary cancer 1972 3.20929197124905E-5
subependymal giant cell astrocytoma 2287 0.0113704324386312
astrocytoma 1493 0.0412181452661505
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Cardiovascular system disease 194 0.0 2.0
Disease Target Count Z-score Confidence
Supratentorial primitive neuroectodermal tumor 7 3.771 1.9

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytoma -1.200 0.041
glioblastoma -3.400 0.000
ependymoma -1.600 0.000
group 4 medulloblastoma -3.300 0.000
cystic fibrosis 1.897 0.000
medulloblastoma, large-cell -3.000 0.000
adult high grade glioma -2.900 0.000
subependymal giant cell astrocytoma -2.498 0.011
ovarian cancer -2.700 0.000
pituitary cancer -1.300 0.000
psoriasis -1.400 0.000

Synonym

Accession O94991 B3KNB8 B4DSH5 Q5VT81
Symbols LRRC11
bA364G4.2

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (1)

PMID Text
25426764 This study did not find any evidence supporting the association of Tourette syndrome and SLITRK5.

AA Sequence

MHTCCPPVTLEQDLHRKMHSWMLQTLAFAVTSLVLSCAETIDYYGEICDNACPCEEKDGILTVSCENRGI      1 - 70
ISLSEISPPRFPIYHLLLSGNLLNRLYPNEFVNYTGASILHLGSNVIQDIETGAFHGLRGLRRLHLNNNK     71 - 140
LELLRDDTFLGLENLEYLQVDYNYISVIEPNAFGKLHLLQVLILNDNLLSSLPNNLFRFVPLTHLDLRGN    141 - 210
RLKLLPYVGLLQHMDKVVELQLEENPWNCSCELISLKDWLDSISYSALVGDVVCETPFRLHGRDLDEVSK    211 - 280
QELCPRRLISDYEMRPQTPLSTTGYLHTTPASVNSVATSSSAVYKPPLKPPKGTRQPNKPRVRPTSRQPS    281 - 350
KDLGYSNYGPSIAYQTKSPVPLECPTACSCNLQISDLGLNVNCQERKIESIAELQPKPYNPKKMYLTENY    351 - 420
IAVVRRTDFLEATGLDLLHLGNNRISMIQDRAFGDLTNLRRLYLNGNRIERLSPELFYGLQSLQYLFLQY    421 - 490
NLIREIQSGTFDPVPNLQLLFLNNNLLQAMPSGVFSGLTLLRLNLRSNHFTSLPVSGVLDQLKSLIQIDL    491 - 560
HDNPWDCTCDIVGMKLWVEQLKVGVLVDEVICKAPKKFAETDMRSIKSELLCPDYSDVVVSTPTPSSIQV    561 - 630
PARTSAVTPAVRLNSTGAPASLGAGGGASSVPLSVLILSLLLVFIMSVFVAAGLFVLVMKRRKKNQSDHT    631 - 700
STNNSDVSSFNMQYSVYGGGGGTGGHPHAHVHHRGPALPKVKTPAGHVYEYIPHPLGHMCKNPIYRSREG    701 - 770
NSVEDYKDLHELKVTYSSNHHLQQQQQPPPPPQQPQQQPPPQLQLQPGEEERRESHHLRSPAYSVSTIEP    771 - 840
REDLLSPVQDADRFYRGILEPDKHCSTTPAGNSLPEYPKFPCSPAAYTFSPNYDLRRPHQYLHPGAGDSR    841 - 910
LREPVLYSPPSAVFVEPNRNEYLELKAKLNVEPDYLEVLEKQTTFSQF                          911 - 958
//

Text Mined References (10)

PMID Year Title
25426764 2015 Association study of the SLITRK5 gene and Tourette syndrome.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
16212419 Phosphoproteome analysis of HeLa cells using stable isotope labeling with amino acids in cell culture (SILAC).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14557068 2003 Human SLITRK family genes: genomic organization and expression profiling in normal brain and brain tumor tissue.
14550773 2003 Identification and characterization of Slitrk, a novel neuronal transmembrane protein family controlling neurite outgrowth.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10048485 1998 Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.