Property Summary

NCBI Gene PubMed Count 28
Grant Count 7
R01 Count 1
Funding $921,915.13
PubMed Score 18.02
PubTator Score 18.62

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

Gene RIF (12)

PMID Text
24997597 Plk4 is intricately regulated in time and space through ordered interactions with two distinct scaffolds, Cep192 and Cep152, and a failure in this process may lead to human cancer.
24277814 Loss of the Cep192- or Cep152-dependent interaction with Plk4 resulted in impaired centriole duplication that led to delayed cell proliferation.
24137814 Found that both sc-54 and ab18 antibodies recognize not only Cdk1 but also Cep152 in Western blot and immunofluorescence assays.
23936128 both mouse and human Cep63 and Cep152 cooperate to ensure efficient centriole duplication by promoting the accumulation of essential centriole duplication factors upstream of SAS-6 recruitment and procentriole formation.
23641073 cooperation between Cep192 and Cep152 is crucial for centriole recruitment of Plk4 and centriole duplication during the cell cycle.
23333316 Cep57, Cep63, and Cep152 are parts of a ring-like complex localizing around the proximal end of centrioles.
21131973 CEP152 is a genome maintenance protein disrupted in Seckel syndrome
21059850 Data show that Cep152 can be phosphorylated by Plk4 in vitro, suggesting that Cep152 acts with Plk4 to initiate centriole formation.
21059844 Results suggest that Cep152 recruits Plk4 and CPAP to the centrosome to ensure a faithful centrosome duplication process.
20852615 Drosophila Asl and human CEP152 are required for the centrosomal loading of Plk4 in Drosophila and CPAP in human cells, respectively
More...

AA Sequence

MSLDFGSVALPVQNEDEEYDEEDYEREKELQQLLTDLPHDMLDDDLSSPELQYSDCSEDGTDGQPHHPEQ      1 - 70
LEMSWNEQMLPKSQSVNGYNEIQSLYAGEKCGNVWEENRSKTEDRHPVYHPEEGGDEGGSGYSPPSKCEQ     71 - 140
TDLYHLPENFRPYTNGQKQEFNNQATNVIKFSDPQWNHFQGPSCQGLEPYNKVTYKPYQSSAQNNGSPAQ    141 - 210
EITGSDTFEGLQQQFLGANENSAENMQIIQLQVLNKAKERQLENLIEKLNESERQIRYLNHQLVIIKDEK    211 - 280
DGLTLSLRESQKLFQNGKEREIQLEAQIKALETQIQALKVNEEQMIKKSRTTEMALESLKQQLVDLHHSE    281 - 350
SLQRAREQHESIVMGLTKKYEEQVLSLQKNLDATVTALKEQEDICSRLKDHVKQLERNQEAIKLEKTEII    351 - 420
NKLTRSLEESQKQCAHLLQSGSVQEVAQLQFQLQQAQKAHAMSANMNKALQEELTELKDEISLYESAAKL    421 - 490
GIHPSDSEGELNIELTESYVDLGIKKVNWKKSKVTSIVQEEDPNEELSKDEFILKLKAEVQRLLGSNSMK    491 - 560
RHLVSQLQNDLKDCHKKIEDLHQVKKDEKSIEVETKTDTSEKPKNQLWPESSTSDVVRDDILLLKNEIQV    561 - 630
LQQQNQELKETEGKLRNTNQDLCNQMRQMVQDFDHDKQEAVDRCERTYQQHHEAMKTQIRESLLAKHALE    631 - 700
KQQLFEAYERTHLQLRSELDKLNKEVTAVQECYLEVCREKDNLELTLRKTTEKEQQTQEKIKEKLIQQLE    701 - 770
KEWQSKLDQTIKAMKKKTLDCGSQTDQVTTSDVISKKEMAIMIEEQKCTIQQNLEQEKDIAIKGAMKKLE    771 - 840
IELELKHCENITKQVEIAVQNAHQRWLGELPELAEYQALVKAEQKKWEEQHEVSVNKRISFAVSEAKEKW    841 - 910
KSELENMRKNILPGKELEEKIHSLQKELELKNEEVPVVIRAELAKARSEWNKEKQEEIHRIQEQNEQDYR    911 - 980
QFLDDHRNKINEVLAAAKEDFMKQKTELLLQKETELQTCLDQSRREWTMQEAKRIQLEIYQYEEDILTVL    981 - 1050
GVLLSDTQKEHISDSEDKQLLEIMSTCSSKWMSVQYFEKLKGCIQKAFQDTLPLLVENADPEWKKRNMAE   1051 - 1120
LSKDSASQGTGQGDPGPAAGHHAQPLALQATEAEADKKKVLEIKDLCCGHCFQELEKAKQECQDLKGKLE   1121 - 1190
KCCRHLQHLERKHKAVVEKIGEENNKVVEELIEENNDMKNKLEELQTLCKTPPRSLSAGAIENACLPCSG   1191 - 1260
GALEELRGQYIKAVKKIKCDMLRYIQESKERAAEMVKAEVLRERQETARKMRKYYLICLQQILQDDGKEG   1261 - 1330
AEKKIMNAASKLATMAKLLETPISSKSQSKTTQSALPLTSEMLIAVKKSKRNDVNQKIPCCIESKSNSVN   1331 - 1400
TITRTLCEQAPKRRAACNLQRLLENSEHQSIKHVGSKETHLEFQFGDGSCKHLNSLPRNVSPEFVPCEGE   1401 - 1470
GGFGLHKKKDLLSDNGSESLPHSAAYPFLGTLGNKPSPRCTPGPSESGCMHITFRDSNERLGLKVYKCNP   1471 - 1540
LMESENAASEKSQGLDVQEPPVKDGGDLSDCLGWPSSSATLSFDSREASFVHGRPQGTLEIPSESVKSKQ   1541 - 1610
FSPSGYLSDTEESNMICQTMKCQRYQTPYLSEETTYLEPGKISVNCGHPSRHKADRLKSDFKKLSSTLPS   1611 - 1680
SVCQQPSRKLIVPLSSQQDSGFDSPFVNLD                                           1681 - 1710
//

Text Mined References (33)

PMID Year Title
26337392 2015 MDM1 is a microtubule-binding protein that negatively regulates centriole duplication.
26297806 2015 Centriolar satellites assemble centrosomal microcephaly proteins to recruit CDK2 and promote centriole duplication.
24997597 2014 Molecular basis for unidirectional scaffold switching of human Plk4 in centriole biogenesis.
24613305 2014 Proximity interactions among centrosome components identify regulators of centriole duplication.
24277814 2013 Hierarchical recruitment of Plk4 and regulation of centriole biogenesis by two centrosomal scaffolds, Cep192 and Cep152.
24137814 2013 Commercial Cdk1 antibodies recognize the centrosomal protein Cep152.
23936128 2013 Cep63 and cep152 cooperate to ensure centriole duplication.
23728906 2013 A genome-wide association study of sleep habits and insomnia.
23641073 2013 Human Cep192 and Cep152 cooperate in Plk4 recruitment and centriole duplication.
23333316 2013 Selective chemical crosslinking reveals a Cep57-Cep63-Cep152 centrosomal complex.
More...