Property Summary

NCBI Gene PubMed Count 26
PubMed Score 14.99
PubTator Score 12.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.100 2.0e-04
breast carcinoma 1.300 9.5e-03
glioblastoma -1.200 1.1e-08
lung carcinoma 1.500 7.0e-25
medulloblastoma, large-cell -1.200 4.0e-04
non-small cell lung cancer 1.200 1.7e-15
ovarian cancer 1.300 2.4e-03
pancreatic ductal adenocarcinoma liver m... 2.338 4.3e-03
sonic hedgehog group medulloblastoma -1.300 1.2e-06
subependymal giant cell astrocytoma -2.162 3.3e-02

Gene RIF (8)

AA Sequence

MLRRPAPALAPAARLLLAGLLCGGGVWAARVNKHKPWLEPTYHGIVTENDNTVLLDPPLIALDKDAPLRF      1 - 70
AESFEVTVTKEGEICGFKIHGQNVPFDAVVVDKSTGEGVIRSKEKLDCELQKDYSFTIQAYDCGKGPDGT     71 - 140
NVKKSHKATVHIQVNDVNEYAPVFKEKSYKATVIEGKQYDSILRVEAVDADCSPQFSQICSYEIITPDVP    141 - 210
FTVDKDGYIKNTEKLNYGKEHQYKLTVTAYDCGKKRATEDVLVKISIKPTCTPGWQGWNNRIEYEPGTGA    211 - 280
LAVFPNIHLETCDEPVASVQATVELETSHIGKGCDRDTYSEKSLHRLCGAAAGTAELLPSPSGSLNWTMG    281 - 350
LPTDNGHDSDQVFEFNGTQAVRIPDGVVSVSPKEPFTISVWMRHGPFGRKKETILCSSDKTDMNRHHYSL    351 - 420
YVHGCRLIFLFRQDPSEEKKYRPAEFHWKLNQVCDEEWHHYVLNVEFPSVTLYVDGTSHEPFSVTEDYPL    421 - 490
HPSKIETQLVVGACWQEFSGVENDNETEPVTVASAGGDLHMTQFFRGNLAGLTLRSGKLADKKVIDCLYT    491 - 560
CKEGLDLQVLEDSGRGVQIQAHPSQLVLTLEGEDLGELDKAMQHISYLNSRQFPTPGIRRLKITSTIKCF    561 - 630
NEATCISVPPVDGYVMVLQPEEPKISLSGVHHFARAASEFESSEGVFLFPELRIISTITREVEPEGDGAE    631 - 700
DPTVQESLVSEEIVHDLDTCEVTVEGEELNHEQESLEVDMARLQQKGIEVSSSELGMTFTGVDTMASYEE    701 - 770
VLHLLRYRNWHARSLLDRKFKLICSELNGRYISNEFKVEVNVIHTANPMEHANHMAAQPQFVHPEHRSFV    771 - 840
DLSGHNLANPHPFAVVPSTATVVIVVCVSFLVFMIILGVFRIRAAHRRTMRDQDTGKENEMDWDDSALTI    841 - 910
TVNPMETYEDQHSSEEEEEEEEEEESEDGEEEDDITSAESESSEEEEGEQGDPQNATRQQQLEWDDSTLS    911 - 980
Y//

Text Mined References (28)

PMID Year Title