Property Summary

NCBI Gene PubMed Count 24
Grant Count 2
R01 Count 1
Funding $173,859.5
PubMed Score 14.27
PubTator Score 12.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Synonym

Accession O94985 A8K183 Q5SR52 Q5UE58 Q71MN0 Q8N4K9
Symbols CST-1
CSTN1
CDHR12
PIK3CD
ALC-ALPHA
XB31alpha
alcalpha1
alcalpha2

Gene

PANTHER Protein Class (1)

 Grant Application (2)

Gene RIF (6)

PMID Text
24305499 Increased plasma p3-Alcalpha35, a major fragment of alcalpha1, may indicate an endophenotype in Alzheimer's disease patients with progressive cognitive impairment.
22571980 Increased plasma p3-alcadein (alc) alpha, evident in the early stages of cognitive impairment, suggests that alc metabolites are useful plasma biomarkers of Alzheimer's disease.
22434822 findings show that calsyntenin-1 is reduced in Alzheimer's disease brains and that the extent of this reduction correlates with increased amyloid-beta
21555518 CLSTN1 is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells.
21385839 Phosphorylation of KLC1 at serine 460 modulates binding and trafficking of calsyntenin-1.
15037614 Alcadein and amyloid beta-protein precursor regulates FE65-dependent gene transactivation [alcalpha1, alcbeta, alcgamma]

AA Sequence

MLRRPAPALAPAARLLLAGLLCGGGVWAARVNKHKPWLEPTYHGIVTENDNTVLLDPPLIALDKDAPLRF      1 - 70
AESFEVTVTKEGEICGFKIHGQNVPFDAVVVDKSTGEGVIRSKEKLDCELQKDYSFTIQAYDCGKGPDGT     71 - 140
NVKKSHKATVHIQVNDVNEYAPVFKEKSYKATVIEGKQYDSILRVEAVDADCSPQFSQICSYEIITPDVP    141 - 210
FTVDKDGYIKNTEKLNYGKEHQYKLTVTAYDCGKKRATEDVLVKISIKPTCTPGWQGWNNRIEYEPGTGA    211 - 280
LAVFPNIHLETCDEPVASVQATVELETSHIGKGCDRDTYSEKSLHRLCGAAAGTAELLPSPSGSLNWTMG    281 - 350
LPTDNGHDSDQVFEFNGTQAVRIPDGVVSVSPKEPFTISVWMRHGPFGRKKETILCSSDKTDMNRHHYSL    351 - 420
YVHGCRLIFLFRQDPSEEKKYRPAEFHWKLNQVCDEEWHHYVLNVEFPSVTLYVDGTSHEPFSVTEDYPL    421 - 490
HPSKIETQLVVGACWQEFSGVENDNETEPVTVASAGGDLHMTQFFRGNLAGLTLRSGKLADKKVIDCLYT    491 - 560
CKEGLDLQVLEDSGRGVQIQAHPSQLVLTLEGEDLGELDKAMQHISYLNSRQFPTPGIRRLKITSTIKCF    561 - 630
NEATCISVPPVDGYVMVLQPEEPKISLSGVHHFARAASEFESSEGVFLFPELRIISTITREVEPEGDGAE    631 - 700
DPTVQESLVSEEIVHDLDTCEVTVEGEELNHEQESLEVDMARLQQKGIEVSSSELGMTFTGVDTMASYEE    701 - 770
VLHLLRYRNWHARSLLDRKFKLICSELNGRYISNEFKVEVNVIHTANPMEHANHMAAQPQFVHPEHRSFV    771 - 840
DLSGHNLANPHPFAVVPSTATVVIVVCVSFLVFMIILGVFRIRAAHRRTMRDQDTGKENEMDWDDSALTI    841 - 910
TVNPMETYEDQHSSEEEEEEEEEEESEDGEEEDDITSAESESSEEEEGEQGDPQNATRQQQLEWDDSTLS    911 - 980
Y//

Text Mined References (26)

PMID Year Title
25009257 2014 Calsyntenin-1 regulates axon branching and endosomal trafficking during sensory neuron development in vivo.
24623842 2014 GABRA1 and STXBP1: novel genetic causes of Dravet syndrome.
24613359 2014 Calsyntenins function as synaptogenic adhesion molecules in concert with neurexins.
24305499 2014 Increased levels of plasma p3-alc?35, a major fragment of Alcadein? by ?-secretase cleavage, in Alzheimer's disease.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23213470 2012 Calsyntenin-1 shelters APP from proteolytic processing during anterograde axonal transport.
22905201 2012 Constitutive cleavage of the single-pass transmembrane protein alcadein? prevents aberrant peripheral retention of Kinesin-1.
22571980 2012 Potential utility of soluble p3-alcadein ? plasma levels as a biomarker for sporadic Alzheimer's disease.
22434822 2012 Calsyntenin-1 mediates axonal transport of the amyloid precursor protein and regulates A? production.
21555518 2011 The BTB and CNC homology 1 (BACH1) target genes are involved in the oxidative stress response and in control of the cell cycle.
More...