Property Summary

NCBI Gene PubMed Count 24
PubMed Score 14.27
PubTator Score 12.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 7.00581684574149E-25
non-small cell lung cancer 2798 1.67221570170962E-15
glioblastoma 5572 1.09878449802224E-8
sonic hedgehog group medulloblastoma 1482 1.21312287250692E-6
adult high grade glioma 2148 2.00528427352706E-4
medulloblastoma, large-cell 6234 4.01810124156443E-4
ovarian cancer 8492 0.00243442254022188
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00430006981562431
breast carcinoma 1614 0.00950043750032151
subependymal giant cell astrocytoma 2287 0.0328644599990569
Disease Target Count Z-score Confidence
Schnyder Corneal Dystrophy 24 3.597 1.8

Expression

  Differential Expression (10)

Synonym

Accession O94985 A8K183 Q5SR52 Q5UE58 Q71MN0 Q8N4K9
Symbols CST-1
CSTN1
CDHR12
PIK3CD
ALC-ALPHA
XB31alpha
alcalpha1
alcalpha2

Gene

PANTHER Protein Class (1)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid

Pathway (1)

Gene RIF (6)

PMID Text
24305499 Increased plasma p3-Alcalpha35, a major fragment of alcalpha1, may indicate an endophenotype in Alzheimer's disease patients with progressive cognitive impairment.
22571980 Increased plasma p3-alcadein (alc) alpha, evident in the early stages of cognitive impairment, suggests that alc metabolites are useful plasma biomarkers of Alzheimer's disease.
22434822 findings show that calsyntenin-1 is reduced in Alzheimer's disease brains and that the extent of this reduction correlates with increased amyloid-beta
21555518 CLSTN1 is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells.
21385839 Phosphorylation of KLC1 at serine 460 modulates binding and trafficking of calsyntenin-1.
15037614 Alcadein and amyloid beta-protein precursor regulates FE65-dependent gene transactivation [alcalpha1, alcbeta, alcgamma]

AA Sequence

MLRRPAPALAPAARLLLAGLLCGGGVWAARVNKHKPWLEPTYHGIVTENDNTVLLDPPLIALDKDAPLRF      1 - 70
AESFEVTVTKEGEICGFKIHGQNVPFDAVVVDKSTGEGVIRSKEKLDCELQKDYSFTIQAYDCGKGPDGT     71 - 140
NVKKSHKATVHIQVNDVNEYAPVFKEKSYKATVIEGKQYDSILRVEAVDADCSPQFSQICSYEIITPDVP    141 - 210
FTVDKDGYIKNTEKLNYGKEHQYKLTVTAYDCGKKRATEDVLVKISIKPTCTPGWQGWNNRIEYEPGTGA    211 - 280
LAVFPNIHLETCDEPVASVQATVELETSHIGKGCDRDTYSEKSLHRLCGAAAGTAELLPSPSGSLNWTMG    281 - 350
LPTDNGHDSDQVFEFNGTQAVRIPDGVVSVSPKEPFTISVWMRHGPFGRKKETILCSSDKTDMNRHHYSL    351 - 420
YVHGCRLIFLFRQDPSEEKKYRPAEFHWKLNQVCDEEWHHYVLNVEFPSVTLYVDGTSHEPFSVTEDYPL    421 - 490
HPSKIETQLVVGACWQEFSGVENDNETEPVTVASAGGDLHMTQFFRGNLAGLTLRSGKLADKKVIDCLYT    491 - 560
CKEGLDLQVLEDSGRGVQIQAHPSQLVLTLEGEDLGELDKAMQHISYLNSRQFPTPGIRRLKITSTIKCF    561 - 630
NEATCISVPPVDGYVMVLQPEEPKISLSGVHHFARAASEFESSEGVFLFPELRIISTITREVEPEGDGAE    631 - 700
DPTVQESLVSEEIVHDLDTCEVTVEGEELNHEQESLEVDMARLQQKGIEVSSSELGMTFTGVDTMASYEE    701 - 770
VLHLLRYRNWHARSLLDRKFKLICSELNGRYISNEFKVEVNVIHTANPMEHANHMAAQPQFVHPEHRSFV    771 - 840
DLSGHNLANPHPFAVVPSTATVVIVVCVSFLVFMIILGVFRIRAAHRRTMRDQDTGKENEMDWDDSALTI    841 - 910
TVNPMETYEDQHSSEEEEEEEEEEESEDGEEEDDITSAESESSEEEEGEQGDPQNATRQQQLEWDDSTLS    911 - 980
Y//

Text Mined References (26)

PMID Year Title
25009257 2014 Calsyntenin-1 regulates axon branching and endosomal trafficking during sensory neuron development in vivo.
24623842 2014 GABRA1 and STXBP1: novel genetic causes of Dravet syndrome.
24613359 2014 Calsyntenins function as synaptogenic adhesion molecules in concert with neurexins.
24305499 2014 Increased levels of plasma p3-alc?35, a major fragment of Alcadein? by ?-secretase cleavage, in Alzheimer's disease.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23213470 2012 Calsyntenin-1 shelters APP from proteolytic processing during anterograde axonal transport.
22905201 2012 Constitutive cleavage of the single-pass transmembrane protein alcadein? prevents aberrant peripheral retention of Kinesin-1.
22571980 2012 Potential utility of soluble p3-alcadein ? plasma levels as a biomarker for sporadic Alzheimer's disease.
22434822 2012 Calsyntenin-1 mediates axonal transport of the amyloid precursor protein and regulates A? production.
21555518 2011 The BTB and CNC homology 1 (BACH1) target genes are involved in the oxidative stress response and in control of the cell cycle.
More...