Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.91
PubTator Score 3.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
acute myeloid leukemia 1.100 2.5e-02
adult high grade glioma -1.600 3.1e-05
Astrocytoma, Pilocytic -1.100 3.4e-06
atypical teratoid / rhabdoid tumor -1.900 4.3e-10
ependymoma -1.800 6.8e-15
glioblastoma -1.500 3.3e-09
group 3 medulloblastoma -1.400 1.4e-03
medulloblastoma, large-cell -2.400 1.2e-05
oligodendroglioma -1.100 3.1e-19
ovarian cancer -1.100 6.1e-08
primitive neuroectodermal tumor -1.200 8.3e-07
subependymal giant cell astrocytoma -1.739 1.9e-02

AA Sequence

MNTKDTTEVAENSHHLKIFLPKKLLECLPRCPLLPPERLRWNTNEEIASYLITFEKHDEWLSCAPKTRPQ      1 - 70
NGSIILYNRKKVKYRKDGYLWKKRKDGKTTREDHMKLKVQGMECLYGCYVHSSIVPTFHRRCYWLLQNPD     71 - 140
IVLVHYLNVPALEDCGKGCSPIFCSISSDRREWLKWSREELLGQLKPMFHGIKWSCGNGTEEFSVEHLVQ    141 - 210
QILDTHPTKPAPRTHACLCSGGLGSGSLTHKCSSTKHRIISPKVEPRALTLTSIPHAHPPEPPPLIAPLP    211 - 280
PELPKAHTSPSSSSSSSSSGFAEPLEIRPSPPTSRGGSSRGGTAILLLTGLEQRAGGLTPTRHLAPQADP    281 - 350
RPSMSLAVVVGTEPSAPPAPPSPAFDPDRFLNSPQRGQTYGGGQGVSPDFPEAEAAHTPCSALEPAAALE    351 - 420
PQAAARGPPPQSVAGGRRGNCFFIQDDDSGEELKGHGAAPPIPSPPPSPPPSPAPLEPSSRVGRGEALFG    421 - 490
GPVGASELEPFSLSSFPDLMGELISDEAPSIPAPTPQLSPALSTITDFSPEWSYPEGGVKVLITGPWTEA    491 - 560
AEHYSCVFDHIAVPASLVQPGVLRCYCPAHEVGLVSLQVAGREGPLSASVLFEYRARRFLSLPSTQLDWL    561 - 630
SLDDNQFRMSILERLEQMEKRMAEIAAAGQVPCQGPDAPPVQDEGQGPGFEARVVVLVESMIPRSTWKGP    631 - 700
ERLAHGSPFRGMSLLHLAAAQGYARLIETLSQWRSVETGSLDLEQEVDPLNVDHFSCTPLMWACALGHLE    701 - 770
AAVLLFRWNRQALSIPDSLGRLPLSVAHSRGHVRLARCLEELQRQEPSVEPPFALSPPSSSPDTGLSSVS    771 - 840
SPSELSDGTFSVTSAYSSAPDGSPPPAPLPASEMTMEDMAPGQLSSGVPEAPLLLMDYEATNSKGPLSSL    841 - 910
PALPPASDDGAAPEDADSPQAVDVIPVDMISLAKQIIEATPERIKREDFVGLPEAGASMRERTGAVGLSE    911 - 980
TMSWLASYLENVDHFPSSTPPSELPFERGRLAVPSAPSWAEFLSASTSGKMESDFALLTLSDHEQRELYE    981 - 1050
AARVIQTAFRKYKGRRLKEQQEVAAAVIQRCYRKYKQLTWIALKFALYKKMTQAAILIQSKFRSYYEQKR   1051 - 1120
FQQSRRAAVLIQQHYRSYRRRPGPPHRTSATLPARNKGSFLTKKQDQAARKIMRFLRRCRHRMRELKQNQ   1121 - 1190
ELEGLPQPGLAT                                                             1191 - 1202
//

Text Mined References (13)

PMID Year Title