Property Summary

NCBI Gene PubMed Count 39
PubMed Score 4.63
PubTator Score 13.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Alzheimer's disease 644
Disease Target Count P-value
posterior fossa group B ependymoma 1530 1.85496374654553E-7
ovarian cancer 8492 2.21929566616996E-5
subependymal giant cell astrocytoma 2287 0.0129970370599932
spina bifida 1064 0.0375190743557201
Disease Target Count Z-score Confidence
Wolff-Parkinson-White syndrome 11 4.072 2.0

Expression

  Differential Expression (4)

Disease log2 FC p
posterior fossa group B ependymoma -1.100 0.000
subependymal giant cell astrocytoma -1.618 0.013
spina bifida 1.048 0.038
ovarian cancer 1.600 0.000

Synonym

Accession O94973 O75403 Q53ET1 Q96SI8
Symbols HIP9
HYPJ
ADTAB
HIP-9
CLAPA2

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA Inparanoid
Chicken OMA Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG
S.cerevisiae OMA EggNOG

Gene RIF (21)

PMID Text
26269175 HIV-1 Env gp41 requires the conserved membrane-proximal AP2A2 binding site in the gp41 cytoplasmic tail to evade antibody-dependent cell-mediated cytotoxicity (ADCC) via membrane-proximal endocytosis
25496667 HIV-1 Env gp41 requires the conserved membrane-proximal AP2A2 binding site in the gp41 cytoplasmic tail to evade antibody-dependent cell-mediated cytotoxicity (ADCC) via membrane-proximal endocytosis
23705972 HIV-1 Env gp41 requires the conserved membrane-proximal AP2A2 binding site in the gp41 cytoplasmic tail to evade antibody-dependent cell-mediated cytotoxicity (ADCC) via membrane-proximal endocytosis
23077317 HIV-1 Env gp41 requires the conserved membrane-proximal AP2A2 binding site in the gp41 cytoplasmic tail to evade antibody-dependent cell-mediated cytotoxicity (ADCC) via membrane-proximal endocytosis
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
22103831 HIV-1 Env gp41 requires the conserved membrane-proximal AP2A2 binding site in the gp41 cytoplasmic tail to evade antibody-dependent cell-mediated cytotoxicity (ADCC) via membrane-proximal endocytosis
21762802 HIV-1 Env gp41 requires the conserved membrane-proximal AP2A2 binding site in the gp41 cytoplasmic tail to evade antibody-dependent cell-mediated cytotoxicity (ADCC) via membrane-proximal endocytosis
20594957 HIV-1 Env gp41 requires the conserved membrane-proximal AP2A2 binding site in the gp41 cytoplasmic tail to evade antibody-dependent cell-mediated cytotoxicity (ADCC) via membrane-proximal endocytosis
20012524 HIV-1 Env gp41 requires the conserved membrane-proximal AP2A2 binding site in the gp41 cytoplasmic tail to evade antibody-dependent cell-mediated cytotoxicity (ADCC) via membrane-proximal endocytosis
19802344 HIV-1 Env gp41 requires the conserved membrane-proximal AP2A2 binding site in the gp41 cytoplasmic tail to evade antibody-dependent cell-mediated cytotoxicity (ADCC) via membrane-proximal endocytosis
More...

AA Sequence

MPAVSKGDGMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLLGH      1 - 70
DIDFGHMEAVNLLSSNRYTEKQIGYLFISVLVNSNSELIRLINNAIKNDLASRNPTFMGLALHCIASVGS     71 - 140
REMAEAFAGEIPKVLVAGDTMDSVKQSAALCLLRLYRTSPDLVPMGDWTSRVVHLLNDQHLGVVTAATSL    141 - 210
ITTLAQKNPEEFKTSVSLAVSRLSRIVTSASTDLQDYTYYFVPAPWLSVKLLRLLQCYPPPDPAVRGRLT    211 - 280
ECLETILNKAQEPPKSKKVQHSNAKNAVLFEAISLIIHHDSEPNLLVRACNQLGQFLQHRETNLRYLALE    281 - 350
SMCTLASSEFSHEAVKTHIETVINALKTERDVSVRQRAVDLLYAMCDRSNAPQIVAEMLSYLETADYSIR    351 - 420
EEIVLKVAILAEKYAVDYTWYVDTILNLIRIAGDYVSEEVWYRVIQIVINRDDVQGYAAKTVFEALQAPA    421 - 490
CHENLVKVGGYILGEFGNLIAGDPRSSPLIQFHLLHSKFHLCSVPTRALLLSTYIKFVNLFPEVKPTIQD    491 - 560
VLRSDSQLRNADVELQQRAVEYLRLSTVASTDILATVLEEMPPFPERESSILAKLKKKKGPSTVTDLEDT    561 - 630
KRDRSVDVNGGPEPAPASTSAVSTPSPSADLLGLGAAPPAPAGPPPSSGGSGLLVDVFSDSASVVAPLAP    631 - 700
GSEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTPTLICSDDLQPNLNLQ    701 - 770
TKPVDPTVEGGAQVQQVVNIECVSDFTEAPVLNIQFRYGGTFQNVSVQLPITLNKFFQPTEMASQDFFQR    771 - 840
WKQLSNPQQEVQNIFKAKHPMDTEVTKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTQIGCLLRLEPN    841 - 910
LQAQMYRLTLRTSKEAVSQRLCELLSAQF                                             911 - 939
//

Text Mined References (48)

PMID Year Title
25241909 2014 Genetic susceptibility for chronic bronchitis in chronic obstructive pulmonary disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24162737 2013 Meta-analysis of 74,046 individuals identifies 11 new susceptibility loci for Alzheimer's disease.
24097348 2013 ?TAT1 catalyses microtubule acetylation at clathrin-coated pits.
22484487 2012 Distinct and separable activities of the endocytic clathrin-coat components Fcho1/2 and AP-2 in developmental patterning.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
22323290 2012 FCH domain only-2 organizes clathrin-coated structures and interacts with Disabled-2 for low-density lipoprotein receptor endocytosis.
21269460 2011 Initial characterization of the human central proteome.
19359243 2009 HM1.24 is internalized from lipid rafts by clathrin-mediated endocytosis through interaction with alpha-adaptin.
19129443 2009 A basic patch on alpha-adaptin is required for binding of human immunodeficiency virus type 1 Nef and cooperative assembly of a CD4-Nef-AP-2 complex.
More...